KEGG   Melissococcus plutonius ATCC 35311: MPTP_0241Help
Entry
MPTP_0241         CDS       T01492                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MPTP_0241
Enzymes [BR:mps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MPTP_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249694..250308
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKAIFDSENNDFQYSISMTTRKKRGGEVDGVDYHFRSRE
EFEAMIEAGEMLEYAEYVGNYYGTPLTYVNKTLDEGKDVFLEIEVQGAKQVREKVSDGIF
IFLTPPDLAELKSRIINRGTDDPEIIEERMRVAREEIEMMAVYDYAVVNDDVSVAVQKIK
NIIASEHFRVRHVIGKYIKMLKEI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgtggattattgattgtactatcaggtccatccggagttggaaagggaaca
gtaagaaaagctatctttgatagtgagaacaatgattttcagtattctatttctatgact
actcgtaaaaagcgaggaggagaggtagatggcgtcgactatcattttcgttcacgtgag
gaatttgaggcgatgatcgaagcaggggaaatgttggaatacgctgaatatgtaggaaat
tattatggtacgccattaacttacgtaaacaagactttagatgagggaaaagatgtattt
ttagagattgaggtacagggtgcaaaacaagtcagagaaaaagtatctgatggtatcttt
atctttttaacaccacctgatttagcagaattaaaatcacgcattatcaatcggggaaca
gatgatcctgaaattattgaagagcgtatgcgggttgctcgtgaggaaatagaaatgatg
gctgtttatgattatgcagttgtgaatgatgatgtttcagtagctgttcaaaaaattaaa
aatattattgcaagtgaacattttcgtgttagacatgttattggaaagtatataaaaatg
ttaaaggagatttaa

DBGET integrated database retrieval system