KEGG   Melissococcus plutonius ATCC 35311: MPTP_0243Help
Entry
MPTP_0243         CDS       T01492                                 

Definition
proline racemase (EC:5.1.1.4)
Orthology
K01777  
proline racemase [EC:5.1.1.4]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mps00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251811..252827
Genome map
AA seq 338 aa AA seqDB search
MKISRMIAAIDTHTSGEAARLIIGGITKFPGKTMAEKKAYLEKKSDHLRKILMYEPRGHK
DMFGAFITEPVNEEADYGIIFMDAGGYLNMCGHNTIAAMTTAVEQGWVKVAKDDREVTVV
QDTPAGVVHGKVQLDGEQSVISVSFENVPAFLYKKDIEVNVPGIGKLIVDISFGGSFFVL
LPAKSVDLNIEPKNSEKFSKIGLKIRNAVNEQIEIQHPTLKHINQVDLVEFYGSAVSSDA
NYQNVVVFGDGQVDRSPCGTGTCAKLATLYGKGQMNIGESFIYESILQTKFKGQIIKETM
VDNYKAIIPCITGSAYITGFNTFLVNPKDPLKDGFILG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctcaagaatgattgcagcaattgatactcacacgtctggcgaagcggcacga
ttaatcattggaggcattaccaaatttcctggtaaaaccatggctgagaaaaaagcatat
ctagaaaaaaaaagtgatcatttacgtaagattttgatgtatgaaccacgtggacataag
gatatgtttggtgcttttattacagaaccggttaatgaagaggcagattatggaattatt
tttatggatgcaggtggttatttaaatatgtgtggtcataatactattgcagcaatgact
acagcggttgaacaaggttgggtaaaggtagctaaagatgatagagaagtaacagtcgta
caagatacacccgcaggggttgttcatgggaaggtacaattagacggagagcaatctgtg
atttctgtttcctttgaaaatgttcctgcttttctttataaaaaagatattgaagtaaat
gtacctggaattggcaaattaatcgttgatatttcatttggaggtagtttctttgtatta
ttacctgctaaatcagtagatttaaatattgaacctaaaaattcagagaaattcagtaaa
attggattaaagattcggaatgctgttaatgagcagattgaaattcagcatccaactttg
aaacatattaatcaggtagatttagtagaattttatggttcggcagttagttcagatgct
aattatcaaaatgttgttgtttttggtgatggacaagtggatcgttctccttgtggaaca
ggtacctgtgcaaaattagctacattgtatggaaagggacaaatgaatataggagaatca
tttatttatgaaagtatcttacaaacaaagtttaagggacaaattataaaagagactatg
gtggataattacaaagcaattattccttgtattactggttcagcttatattactggtttt
aacacatttttagttaatccgaaagatcccttaaaagatggatttattctgggataa

DBGET integrated database retrieval system