KEGG   Melissococcus plutonius ATCC 35311: MPTP_0339Help
Entry
MPTP_0339         CDS       T01492                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MPTP_0339
Enzymes [BR:mps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MPTP_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361564..362241
Genome map
AA seq 225 aa AA seqDB search
MNKVTILGSSNIDLVISTKSLPQVGETILGDQLDYFYGGKGQNQAISSVRIGANVQLIGA
VGTDSFGEKILANLKTEGISTENIRQVEGAFTGLAMVLKLPQDNSIIVAPGANELVNPDY
LTNFTKKIITSDVLLVQMEIPFETVLASIKIAKRNQVITIVNPAPYSERCHELLEFTDVL
TPNKTEFEYLYGEKLTNEAMLEEAMLHFVKGYAVSLVVTRGSRGS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtaactattttaggtagtagtaatatcgatttagtaatttcaactaaaagt
cttccacaggttggagaaacgattttgggagatcaactagactatttttatggtggaaaa
ggccaaaaccaagctatttctagtgtgagaataggtgccaatgttcaattaatcggagct
gtaggaacagattcttttggagaaaaaattctagcaaatttaaaaacggaagggatatcg
actgaaaacattaggcaggtagaaggagcatttaccggactagcaatggttttaaaatta
cctcaagataattctattattgtagcacctggtgcaaatgaacttgttaatccagattat
ttaactaactttacaaaaaaaataattacaagtgatgtcttgttggtacaaatggaaatt
ccttttgaaactgtattagcgagtattaaaatagcgaaacgaaatcaagtcattacaatt
gtaaatccagctccctatagcgaaagatgtcatgaattgctagaatttactgatgtttta
acaccaaataaaacagaatttgaatatttatatggtgaaaaattaacgaatgaagcgatg
cttgaagaggcaatgctgcattttgtgaaaggatatgctgtttctttagttgttactcga
ggaagtcgggggagttag

DBGET integrated database retrieval system