KEGG   Melissococcus plutonius ATCC 35311: MPTP_0374Help
Entry
MPTP_0374         CDS       T01492                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPTP_0374
   00051 Fructose and mannose metabolism
    MPTP_0374
Enzymes [BR:mps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     MPTP_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397808..399112
Genome map
AA seq 434 aa AA seqDB search
MYFPEVKKVTFEGTTTNNSFAFRHYNPDEVILGKSMKEHLRFALAYWHTMTQDGTDPFGD
PSHIRTWFGETPMETAKNRVEAFFEILEKLDVDYFCFHDVDIAPQGDSLEEFFNNIDEIT
DLIKEKMEKTGKKLLWNTANLFSHPRFTNGAASSNNAEVFAIAAAQVKKGLDINKKLNGE
NYVFWGGREGYETLLNTDMGFEQDNMARLFKMAIQYGQKINHKPQFLIEPKAMEPSKHQY
DFDAATTMAFIQKYQLEEDFKLNLEANHATLAGHTFDHELTVARTYHALGSIDANQGDPL
LGWDTDEFPTDIYEATFAMYQILENGGIAPCGLNFDAKVRRSSFEMEDLLLSHIAGMDTY
ARGLKAAAKLMESKFLENIKQERYKSYHEGIGQRILDNKEDLESLTTYALQHDQVKLSSS
HIEHVRSLLNDYLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtattttcctgaggtaaaaaaagtgacatttgaaggtactacaacaaacaactctttt
gcatttagacattataatccggatgaagttattttaggtaaatcgatgaaagaacatctg
cgatttgctttagcgtattggcatacaatgactcaagatggtaccgatccttttggcgat
ccttcccatattcgtacttggtttggagaaacaccaatggagacagctaaaaatcgggta
gaagccttttttgaaattttagaaaaattagatgttgattatttttgttttcatgatgtt
gatattgcaccacaaggagattcgttagaagagttttttaataatattgatgagataacc
gatttaatcaaagaaaaaatggaaaaaacaggtaaaaaattactatggaatacggcaaat
ttattttcgcatccaagatttaccaacggtgctgcttcttcaaacaatgcagaagtattt
gccatcgcggcagctcaggtaaaaaagggattagatatcaataaaaaattaaatggtgaa
aattatgttttttggggaggacgtgaaggatacgaaaccttgttgaatacagatatggga
tttgaacaagacaatatggctcgcctgtttaaaatggcgattcaatatggtcaaaaaatc
aaccataaaccacaatttttaatcgaaccgaaagccatggaaccttcaaaacaccaatat
gattttgatgcagcaacaaccatggcatttattcaaaaataccagttagaagaagacttc
aaattaaatttagaagcgaatcatgccacattagctggccatacatttgatcatgaattg
acggttgctcgtacgtatcatgcgttaggctctattgatgcaaatcagggagacccctta
cttggttgggatacggatgaatttcctacagatatttatgaagcaacgtttgcgatgtat
cagattttggaaaatggtgggattgcaccatgtggtctaaattttgatgctaaggtgcgt
cgttcctcatttgaaatggaagatttgttattatctcacattgctggtatggatacttat
gcaagaggattaaaagcagcagcaaaattaatggaatcaaaatttttagaaaatataaaa
caggaacgttacaagagttatcatgaaggcataggacaacgcattttagacaataaagaa
gatttggaaagtttaacaacctatgcacttcaacacgatcaagtaaaattatcgtctagt
catattgaacatgtgagatcgcttttaaatgactatttagtgtag

DBGET integrated database retrieval system