KEGG   Melissococcus plutonius ATCC 35311: MPTP_0413Help
Entry
MPTP_0413         CDS       T01492                                 

Definition
beta-galactosidase 3
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mps00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438852..440645
Genome map
AA seq 597 aa AA seqDB search
MQRFEIKDEFLLNGQPFKILSGAIHYFRLHPDDWYHSLYNLKALGFNTVETYIPWNLHES
QEGNFHFDQQLDIEQFLKVAQSLDLYAILRPSPYICAEWEFGGLPAWLLNKNCRIRSSDP
KYLACVSTYYQQILPRLAKHQLSENGNVLMFQVENEYGSYGEDKEYLTALKKLMKENGIT
APLFTSDGPWQATLRAGSLIDEDILVTGNFGSNAQKNFTEMKKFFKTHGKKWPLMCMEFW
DGWFNRWGEPIVKRETKELVEAFRETIELGSINLYMFHGGTNFGFMNGCSARGNTDLPQI
TSYDYGAPLNEQGNPTDKYYALQETVREVCPVLASSQKMPLIKPTIEIKDIPLKNKVSLF
ATITKLTTLLQTKYPVTMEAMNQTTGYIIYRTILPRDAKTETLRIIDGSDRAQTYLNGQH
IVTQYQAEIGENILVEPTKEQNQLDILIENMGRVNYGAKLTANTQKKGIRTGVMADLHFI
NDWEQFSLPLDTIESVDFSGEWVKNQPSFYQYEVDLTEIEDTFIDLANFGKGVVFVNNHH
LGRFWEIGPTLSLYIPKGFLHIGKNEIVIFETEGKYDSKIDLLNQPKFKSKKRGNKK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttgcagagatttgagataaaagatgaatttttacttaatgggcaaccgtttaaaatttta
tctggtgcgattcactattttagattgcatccagatgactggtatcattctctctataat
ttaaaagcattaggttttaatacagtggaaacctatattccttggaacttacacgaatca
caagagggaaatttccattttgatcagcagttagacattgaacaatttttaaaagtagca
caatcactagacttgtacgccattctaagaccttcaccttatatttgtgctgaatgggaa
tttggtggactacctgcttggttattgaataaaaattgccgaattcgttcctctgatcca
aaatatctcgcttgcgtgtctacctattatcagcaaatattaccgagattagcgaaacat
caactaagtgaaaatggaaatgtgttaatgtttcaagttgagaacgaatatggctcatat
ggggaagataaagaatatttaactgcattaaaaaaattgatgaaagaaaatggcataacg
gcaccactttttacttcggatggtccatggcaggcgacacttagagcaggtagtttgatt
gatgaagatattttggtaacaggaaactttgggtcaaatgctcaaaaaaattttactgaa
atgaaaaagttttttaagacacatgggaaaaaatggccgctgatgtgtatggaattttgg
gatggttggtttaatcgttggggtgaaccaatcgttaaaagagaaaccaaggaattggtg
gaagcttttcgtgagacgattgaacttggtagtatcaatctttatatgtttcatggtggt
accaattttggttttatgaatggctgttcagctcgaggaaatacagacctaccacagatt
acttcctatgattatggtgctcctttaaacgagcaaggaaatccaaccgataaatactat
gccttgcaagaaacagtgagagaagtctgtccagtattagcttcttcacaaaaaatgcca
ttaatcaaaccgacaatcgaaattaaagatattcctttaaaaaataaggtcagtcttttt
gcaacaataaccaaattaactacactattacaaacaaaatatccagtaacaatggaagcg
atgaatcagacgactggttatatcatttatcgaaccattctgccaagggatgcaaaaacg
gaaaccctacgaattattgatggaagtgatcgagcacaaacctatttaaatggccaacat
attgtgacgcaataccaagcagaaattggagaaaatattttagttgaaccaacaaaagaa
caaaaccagctagatattttaatagaaaatatgggacgcgtcaactatggtgcgaaatta
acagcaaatacacagaaaaaagggatccgaacgggagttatggcagacttacattttatt
aatgattgggaacaattttctttacctttagatacgattgaatcagtcgatttttctggt
gaatgggtaaaaaatcaacctagcttttaccaatatgaagttgatttaaccgaaattgaa
gatacttttattgatttagcaaactttggtaagggtgtagtttttgtaaataatcatcac
ctaggtcgtttctgggaaattggtcctactttatccttgtatattccaaaaggctttttg
catattgggaaaaatgaaattgttattttcgaaacagaagggaaatatgattcaaaaatc
gatttattgaatcaaccaaaatttaaatcaaagaaaagaggaaacaaaaaatga

DBGET integrated database retrieval system