KEGG   Melissococcus plutonius ATCC 35311: MPTP_0428Help
Entry
MPTP_0428         CDS       T01492                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mps00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
449405..450451
Genome map
AA seq 348 aa AA seqDB search
MVQKNFLWGGALAAHQFEGGWDAGGKGPSVIDVMTAGAHGVPREITETIEEDKFYPNHEA
IDFYHNYKEDIALFAEMGLKCLRTSIAWTRIFPKGDEEEPNEEGLQFYDNVFDELLKNDI
EPVITLSHFEMPLHLAREYGGFRNRKVIDFFAKFARVVFERYQDKVKYWMTFNEINNQMD
VNNPIFLWTNSGVLVKEGENPKEVMYQVAHNELVASAKAVMIGKEINPNFQIGCMISHVP
IYPYSCNPEDIMAAEEANHQRFFFADVHVRGKYPNYALKEFEREGYNIDIRLEDLAVLKA
GTVDYVGFSYYMSTVVKADAKNDTENNIVNGGLSNGVENPYIQSIDWG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaaagaactttttatggggtggcgcattagccgcacatcaatttgaaggaggc
tgggacgcaggcggcaagggacctagcgtaatcgatgtgatgaccgctggagcacatggt
gtgccaagagaaattacggaaacaattgaagaagataagttttatcctaatcatgaagcc
attgatttttatcataactacaaagaagatattgcactatttgctgaaatgggcttaaaa
tgtctacgaacttctattgcttggacgcgtatttttccaaagggagatgaagaagagcca
aatgaagaaggactacaattttacgacaatgtgtttgatgaattgttgaaaaatgacatt
gaaccggtcattacgctttctcattttgaaatgccactacacctagcaagagaatatggt
ggctttcgtaatcgtaaagtcatcgactttttcgctaaatttgcaagagttgtctttgaa
cgttatcaagataaagttaagtactggatgacattcaatgaaattaataaccaaatggat
gttaataatccgatctttttatggaccaattctggtgtcttggtgaaagaaggcgaaaat
cctaaagaagtgatgtatcaagtggctcataatgaattggtcgctagtgcaaaagccgta
atgatcggcaaagaaatcaatcctaatttccaaattggctgtatgatttctcatgtaccg
atttatccttattcatgtaatccggaagatattatggctgctgaagaagcaaaccatcaa
cgatttttctttgcagacgttcatgtacgaggaaaatatcctaattatgccttaaaagaa
tttgaacgtgaagggtacaacattgatattcgattagaagaccttgctgtgctaaaagct
ggtactgttgattatgttggcttcagctactatatgtcaacggtcgtaaaagcagatgcg
aaaaatgatacagagaacaatattgtaaatggtgggttgtcaaatggggtagaaaaccct
tatattcaatcaatagattggggatga

DBGET integrated database retrieval system