KEGG   Melissococcus plutonius ATCC 35311: MPTP_0437Help
Entry
MPTP_0437         CDS       T01492                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPTP_0437
Enzymes [BR:mps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MPTP_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(459863..461563)
Genome map
AA seq 566 aa AA seqDB search
MKKFIICLLFVGLFSLMGILNSSSAEAQESSSIDYVQKMGKGWNLGNSFDGFDLNNQHAY
EEAWGNPRITREFLKKIKQQGFTSIRLPFSVINRQNTAGKIDPEFLARYKQVVDWAVAEG
FYVMVNLHHDSWQWLAKWNGDKNQSEYLRYVTIWQQLANEFKDESGKVSFESINEPTFEG
SKEQANEKLKTINQAFYQTVRDSGGKNATRYLILPTLYCDANPEAMNLLYQSILAFNDPY
LIATVHYYSEWVYSNSLGIMGFDDLLWDTTTSRKSADRLFQQMNEQLINRGIGVVIGEYG
LLGYDLSEEANDPGETYKYIEYMNKKASENKVSLMLWDNGQHFDRLKNTWKKPFFGDIVT
KSIDERSAYATGYQHTFIKQQTQQIDIPITWNHHKLKNIQYNGELLKEGSDYSSTTVGIT
LLPHFVAQQKQGAFERKDTLTLVFDGGANWLQQIYYSKQSELFDAKGDLGQTFTIPVKYN
GQRFKNGSLKNANGQIISSNPWWNYLINYQEFSPNYQKNNLTLSSDLTKLMQEGMTYTLT
IQTYQGESYTYQIRVVNGQLIGKNFK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttattatttgtttattgtttgttggactgtttagcttaatgggaatacta
aacagtagctctgctgaagcacaagagtcttcttctatcgattatgttcaaaagatggga
aaaggttggaatttaggcaattcgtttgatggatttgatctgaataatcagcatgcttat
gaagaagcttggggaaatccacgaatcacgcgtgagtttttgaaaaaaattaagcaacaa
ggatttactagtattcggttacccttttctgtgattaatcgtcaaaatacagcaggaaaa
atcgatccagaatttctagctcgttataaacaagtcgttgattgggcagttgctgaaggt
ttctatgttatggttaatttacatcacgattcttggcagtggcttgcaaaatggaatggg
gataaaaaccaatctgagtatttacgttatgtgactatttggcagcaacttgctaatgaa
tttaaagatgaatcaggaaaagtcagttttgaatccatcaatgaaccaacgtttgaggga
agtaaagaacaggcaaatgaaaaattgaaaacgattaaccaagctttttatcaaacagta
agagactctggtggtaaaaatgcaactcgttatttaattttgcctaccttatactgtgat
gcgaatccagaagcaatgaatcttttataccagtccatcttagcattcaatgatccctat
ctcattgcaaccgttcattattatagtgagtgggtttatagtaatagtttaggcattatg
gggtttgatgatcttttatgggacacgacaacatcaaggaaaagtgctgatcggctattt
cagcaaatgaatgaacaactaatcaatcgaggtattggcgtagttattggtgagtatggc
ttattaggttatgatctatcagaagaagcgaacgatccgggtgaaacttataaatatatt
gaatatatgaataaaaaagccagtgagaataaagtatccttaatgttgtgggataatgga
caacattttgatcgcttaaaaaatacttggaaaaaacctttctttggtgatattgtaaca
aaatcaatcgatgaacgctctgcttatgccactggttatcaacatacctttatcaagcaa
cagacacaacaaattgatattccaataacttggaatcatcacaaacttaaaaacatccaa
tataatggggaattattaaaagaaggtagcgactattcaagtacaacagttggtattacc
ttacttcctcactttgttgcccaacaaaaacagggtgcttttgagagaaaagacacattg
accttggtttttgatggtggtgcgaactggttacaacagatttattatagcaagcagtct
gaattattcgatgcaaaaggcgatctaggtcaaacgttcactattccagtaaagtataat
ggacaacgatttaaaaatggttctttaaaaaatgccaatggccaaatcatctcaagtaat
ccttggtggaattacctgatcaattaccaagaattttcaccgaattatcaaaaaaataac
ctaactttatcaagtgacctcacaaagttaatgcaagaaggaatgacctatacattaacc
attcaaacctatcaaggcgaatcttatacctatcaaattagagtagtcaatggacaacta
attggtaaaaacttcaaataa

DBGET integrated database retrieval system