KEGG   Melissococcus plutonius ATCC 35311: MPTP_0449Help
Entry
MPTP_0449         CDS       T01492                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MPTP_0449
  Lipid metabolism
   00561 Glycerolipid metabolism
    MPTP_0449
   00600 Sphingolipid metabolism
    MPTP_0449
Enzymes [BR:mps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MPTP_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476937..479081
Genome map
AA seq 714 aa AA seqDB search
MNEKNNPNIQMIEGKKSEIIFMITEAQHVCLLYMGELQRIDENWVKQVQKQTTAFLLTQV
QLTGDNIHHKGIKLSYSGTTDRLHYQEYYVEEKDFGKQVVIVEKDEKTGLIIHSFFQLFN
DSCAIRTFKIAENTGDEAVGIEWLSSLTLAGILQINDFPNNYAEHLEFSVAHNAWTAELQ
WETRTLKEHGINFYVDGEHKQPSSQRINITNNSSWSCSEFSPSGVLFNRFTNQSAGWQIE
HNGAWHYEIGDTGVGNLLYLTLFGPEEYDNHCWIQLKPHATFETVKTAYVQVNGDQEKVL
DELTIYRRLIRRVSKDNQQLPIIFNDYMNCLMGEPTTEVELPLIDAAARAGCEYFVIDCG
WYADGYWWDSVGEWLPSEKRFTNGINEVIKAIHKKGMISGLWLEIEVMGIHCPLADKLPD
DWFFTRHGKRVIDIDRYHLDFRNKEVIAYADQVLDRLITDYGIGYIKMDYNITTGIGTDY
LSDSYGEGLLAHNRAYLNWLDHLFQRYPDLVIENCGSGGMRHDYAMLSRHSLQSLTDQTD
YLRNGAIAAVGASAVTPEQCAVWSYPLEDGDEEEVIYNMINSLLLRVHQSGYLNKLSDNR
FKLVTEGLNVYKQIRQQILKSLPIWPTGLEKLDDSKYTFGLIGDRQLLLAVWNNKQKENL
IEVDLTKYGKVETVTQIYPKAPEYQTTIFNVNNQVAFKFETAPSARLYKITLEK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaaataatcccaatattcagatgattgaagggaaaaagtcagaaattatt
tttatgattacagaagcacaacatgtttgtcttctttatatgggagaattacaaaggata
gatgaaaattgggtaaagcaggttcaaaagcagacaactgcttttctacttacacaagtt
caattaacaggtgataatattcaccataaaggaatcaaactatcttatagtggaacaacg
gatcgtttacactatcaagaatattacgttgaagaaaaagattttggaaagcaagtagtc
attgtagaaaaagatgaaaaaactggactaattattcatagcttctttcaactatttaat
gatagttgtgcaatacgtacatttaagatagctgaaaatacaggagatgaagctgtaggc
attgaatggttatcttcgctaacattggcaggtatcttacaaataaatgattttcctaat
aattatgctgaacatttggaattttcggtggctcataatgcttggacagctgaactacaa
tgggagacaagaacattgaaagaacatggtattaatttttatgtagatggcgaacataaa
caaccttcttcacaacgaattaatattacaaataattcttcttggtcctgttcggaattc
tcacctagtggcgtattgttcaatcgttttacgaatcaaagtgcaggatggcaaattgaa
cataatggtgcgtggcattatgaaattggagatacaggagtaggcaatttactttattta
actctttttggtccagaagaatatgacaatcattgttggattcaattaaaaccacacgct
acctttgaaactgttaaaacagcttacgttcaagtaaatggcgatcaagaaaaagttctt
gatgaattgactatttatagacgtctgattcggcgagtgtctaaagataatcaacaatta
ccaattatttttaatgattatatgaattgtttgatgggagaaccaacaacagaagtcgaa
ttacctttaattgatgcagcagctagagctgggtgtgaatattttgtcatagattgtggt
tggtatgcagatggatattggtgggatagtgttggagaatggctgccttctgagaaaaga
tttactaacgggatcaatgaagttataaaagccattcataaaaaaggaatgatttctgga
ttatggctagaaattgaagtcatggggatccattgtccattggcagataaattaccagat
gattggttttttactcgtcatggaaaacgtgttattgacatcgatcggtaccacttagat
tttcgtaataaagaagtaatcgcttatgcggatcaggtattggatcgtttaattaccgat
tatgggattggttatataaaaatggactataacattaccacaggtataggcaccgattat
ttatcagatagctatggtgaaggactactcgctcataatcgtgcgtatctaaattggtta
gatcacttgtttcaacgatatccagatcttgtaattgaaaattgtgggagcggtggtatg
cgtcatgattatgccatgctttctagacatagccttcaatccttgaccgatcagacggac
tacctacgcaatggcgctattgcagctgttggtgcatctgcagtaacaccggaacaatgt
gctgtttggtcctatcctttagaggatggcgatgaagaagaagtaatctataatatgata
aattcattactacttagagttcatcaaagtgggtatttaaataaattgtcagataatcgt
tttaagttggtaactgaaggattaaacgtatataaacaaattcgtcaacaaattttaaaa
tcattaccaatttggccgacaggattagaaaaattggatgattcaaaatatacttttggt
ctaataggggatcgtcaacttttattagctgtatggaataataaacaaaaggaaaatttg
attgaagtagatttaacaaagtatggaaaggttgaaacagttacccaaatctaccctaag
gcacctgaatatcaaacaacgatttttaatgttaataatcaagtcgcttttaaatttgaa
actgctccaagtgctcgtttgtataaaatcactttagaaaaataa

DBGET integrated database retrieval system