KEGG   Melissococcus plutonius ATCC 35311: MPTP_0476Help
Entry
MPTP_0476         CDS       T01492                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPTP_0476
   00500 Starch and sucrose metabolism
    MPTP_0476
Enzymes [BR:mps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MPTP_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511498..512193
Genome map
AA seq 231 aa AA seqDB search
MAKIYERTPIKKFSVGKGKLYDFTTIQAAIDEATNWDEKIQILIFPGDYQENVRIYGEDI
ELIGIGEVVITSNLAAYQINYQGEERGTFQTATVFINGQTILLKNLSIVNTAGPGEIVGQ
AVALYIEGTDIHIDSCKLDGYQDTLCLGPLPKFQKDGKQLMVSPWLKIPYTEQIVDFHYC
QISGTVDFIFGGGQASSYHCQLYVKRIRIQIILQLHLLRKIKKDFILFHAW
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatttatgaaagaacacctataaaaaaattttcagttggaaagggcaagtta
tatgattttactacaattcaagccgctattgatgaagcaacaaactgggatgagaaaata
cagattctcatttttcctggcgactatcaagaaaatgtaagaatctatggtgaagatatt
gaattaattggcattggtgaagtggttattactagtaatttagctgcttatcaaataaat
tatcaaggtgaggagagaggtacatttcagacagccaccgtttttatcaatggccaaacg
attttattaaagaatttatcgatcgttaatactgctggacctggtgaaattgttggccaa
gctgtagctctttatattgaaggaacagatatccatattgattcttgtaaacttgatggc
tatcaagataccttatgcttaggaccacttcctaagtttcagaaggacggaaaacagcta
atggttagtccatggctaaagatcccttatactgaacagatcgttgattttcactattgc
cagattagtggaactgttgattttatttttggtggtggtcaagctagttcttatcattgt
cagctgtatgtaaaaagaatacgcatacaaattatattacagctgcatctactccgaaaa
atcaaaaaggattttattttgtttcatgcatggtaa

DBGET integrated database retrieval system