KEGG   Melissococcus plutonius ATCC 35311: MPTP_0603Help
Entry
MPTP_0603         CDS       T01492                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPTP_0603
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_0603
   00052 Galactose metabolism
    MPTP_0603
   00500 Starch and sucrose metabolism
    MPTP_0603
   00520 Amino sugar and nucleotide sugar metabolism
    MPTP_0603
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MPTP_0603
   00524 Butirosin and neomycin biosynthesis
    MPTP_0603
Enzymes [BR:mps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MPTP_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
629809..630783
Genome map
AA seq 324 aa AA seqDB search
MMDKKLIGIDLGGTTIKFAILTVDGIIQQKWSVQTNILDEGTHIIDDIVASINHRLALYH
MQPEEFIGIGMGTPGSVDIEKGTVIGAYNLNWNTLQFVKNQVEEETGISFMLDNDANVAV
LGEDWMGAGKNSKDVVFITLGTGVGGGIIAQGQLIHGTKGCAGEIGHVTVDPNGFKCTCG
KRGCLETVSSATGIVRVARQLSEEYVGNSSLKKAIDEGQAVTSKNVFNYAELENDPLALK
VVDRVCYFLGLALGNIGNTLNPNSIIIGGGVSAAGEFLRSRIQTYFDRFTSPQVRESTKL
KLAQLGNEAGVIGAASLALNYLEN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatggataagaaattaattggtattgacctaggtggaactacaatcaaatttgctatt
ttaactgtagatggcattattcaacaaaaatggagtgttcaaacgaatattttagatgag
ggtacccatattattgatgacattgtcgcttcaattaatcatcgactcgctctttatcac
atgcaaccagaagagtttattggaattggcatgggaacaccaggaagtgtcgatattgaa
aaagggacagtcattggtgcatataatttaaattggaataccttacaatttgtaaagaat
caagtagaagaagaaacaggcatttcttttatgttagacaacgatgcaaatgttgctgtt
ctaggtgaagattggatgggagcaggtaaaaatagtaaggatgttgtctttatcacatta
ggcacaggtgttggcggtggcattatcgcacaaggacaattaattcatggaacaaagggt
tgtgctggtgagattggacatgttacggttgatcctaatggattcaaatgtacctgtgga
aaaagagggtgtcttgaaacagtatcaagtgctactggtattgttcgagtagctagacaa
ctatcagaagaatatgttggtaattcttctttaaagaaagccattgatgaagggcaggca
gttacaagtaaaaatgtatttaattatgcagaattagaaaatgatccattggcattaaaa
gtagtagatcgtgtttgttattttttgggacttgctttaggaaatattggcaatacatta
aatccaaatagcattatcattggtggtggtgtctctgcagccggtgaattcttgagaagt
cgtattcaaacatattttgatcgttttacttccccacaagttagagaaagtactaaactc
aagttagcacaattaggaaatgaagccggtgttattggtgcagcctcattagcattaaat
tatttggaaaattag

DBGET integrated database retrieval system