KEGG   Melissococcus plutonius ATCC 35311: MPTP_0603Help
Entry
MPTP_0603         CDS       T01492                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
mps00010  Glycolysis / Gluconeogenesis
mps00052  Galactose metabolism
mps00500  Starch and sucrose metabolism
mps00520  Amino sugar and nucleotide sugar metabolism
mps00521  Streptomycin biosynthesis
mps01100  Metabolic pathways
mps01110  Biosynthesis of secondary metabolites
mps01120  Microbial metabolism in diverse environments
mps01130  Biosynthesis of antibiotics
mps01200  Carbon metabolism
Module
mps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mps_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_0603
   00052 Galactose metabolism
    MPTP_0603
   00500 Starch and sucrose metabolism
    MPTP_0603
   00520 Amino sugar and nucleotide sugar metabolism
    MPTP_0603
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MPTP_0603
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MPTP_0603
Enzymes [BR:mps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MPTP_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: BAK21071
UniProt: F3Y993
Position
629809..630783
Genome map
AA seq 324 aa AA seqDB search
MMDKKLIGIDLGGTTIKFAILTVDGIIQQKWSVQTNILDEGTHIIDDIVASINHRLALYH
MQPEEFIGIGMGTPGSVDIEKGTVIGAYNLNWNTLQFVKNQVEEETGISFMLDNDANVAV
LGEDWMGAGKNSKDVVFITLGTGVGGGIIAQGQLIHGTKGCAGEIGHVTVDPNGFKCTCG
KRGCLETVSSATGIVRVARQLSEEYVGNSSLKKAIDEGQAVTSKNVFNYAELENDPLALK
VVDRVCYFLGLALGNIGNTLNPNSIIIGGGVSAAGEFLRSRIQTYFDRFTSPQVRESTKL
KLAQLGNEAGVIGAASLALNYLEN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatggataagaaattaattggtattgacctaggtggaactacaatcaaatttgctatt
ttaactgtagatggcattattcaacaaaaatggagtgttcaaacgaatattttagatgag
ggtacccatattattgatgacattgtcgcttcaattaatcatcgactcgctctttatcac
atgcaaccagaagagtttattggaattggcatgggaacaccaggaagtgtcgatattgaa
aaagggacagtcattggtgcatataatttaaattggaataccttacaatttgtaaagaat
caagtagaagaagaaacaggcatttcttttatgttagacaacgatgcaaatgttgctgtt
ctaggtgaagattggatgggagcaggtaaaaatagtaaggatgttgtctttatcacatta
ggcacaggtgttggcggtggcattatcgcacaaggacaattaattcatggaacaaagggt
tgtgctggtgagattggacatgttacggttgatcctaatggattcaaatgtacctgtgga
aaaagagggtgtcttgaaacagtatcaagtgctactggtattgttcgagtagctagacaa
ctatcagaagaatatgttggtaattcttctttaaagaaagccattgatgaagggcaggca
gttacaagtaaaaatgtatttaattatgcagaattagaaaatgatccattggcattaaaa
gtagtagatcgtgtttgttattttttgggacttgctttaggaaatattggcaatacatta
aatccaaatagcattatcattggtggtggtgtctctgcagccggtgaattcttgagaagt
cgtattcaaacatattttgatcgttttacttccccacaagttagagaaagtactaaactc
aagttagcacaattaggaaatgaagccggtgttattggtgcagcctcattagcattaaat
tatttggaaaattag

DBGET integrated database retrieval system