KEGG   Melissococcus plutonius ATCC 35311: MPTP_0613Help
Entry
MPTP_0613         CDS       T01492                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MPTP_0613
DNA repair and recombination proteins [BR:mps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MPTP_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639104..639700
Genome map
AA seq 198 aa AA seqDB search
MYYPQPIAKLIESYMKLPGIGQKTAIRLAFYTIDMDEEDVTNFAKSLISVKRDLHFCSNC
GNITEEDLCDICQDKTRDHSTILVIEEPKDITAMEKMREYHGLYHVLNGVLSPMEGTGPE
DINIASLIQRLHNDEIKEVILATNATTEGEATAMYLSRFIKPAGIKVTRLAHGLSVGSDI
EYADEITLLKAIEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccacaacctattgctaaattaattgaaagttatatgaaactgccgggaatt
ggacagaaaacagcgattcggcttgccttttatacaattgatatggatgaagaagatgtt
actaattttgcaaaatctttaatcagtgtcaaaagggatcttcatttttgtagtaattgt
ggaaatattactgaagaggatctttgtgatatttgtcaagataaaacaagagatcatagt
accattttagtaatagaggaacctaaagatattacagcgatggagaagatgcgtgaatat
catggcctttatcatgtacttaatggtgttctttcaccgatggaaggtacaggtcctgaa
gatataaatattgcctctttgattcaacgactgcataatgatgaaataaaagaagttatt
ttagcaacaaatgcaacgactgagggggaagcaactgctatgtatctttcaagatttatt
aaaccagctggtattaaagtaacccgtctagcacatggattatctgtaggtagtgatatt
gaatatgcagatgaaataacacttttaaaagcgattgagggaagaagagaattgtaa

DBGET integrated database retrieval system