KEGG   Melissococcus plutonius ATCC 35311: MPTP_0693Help
Entry
MPTP_0693         CDS       T01492                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MPTP_0693
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_0693
   00620 Pyruvate metabolism
    MPTP_0693
   00650 Butanoate metabolism
    MPTP_0693
  Lipid metabolism
   00071 Fatty acid degradation
    MPTP_0693
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPTP_0693
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MPTP_0693
   00626 Naphthalene degradation
    MPTP_0693
Enzymes [BR:mps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MPTP_0693
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MPTP_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724905..727496
Genome map
AA seq 863 aa AA seqDB search
MAQAKKEVGQEMDIQTMINELAGKANVALKEMANFDQEKVDHIVHQMAIAALDQHMQLAK
LAVEETGRGIVEDKAIKNIYASEYIWNSIKNNKTVGIINEDDQTGLIEIAEPVGVICGVT
PTTNPTSTTIFKSLIALKTRNPIIFAFHPSAQQCSKKAAMIVRDSAIQAGAPENCVQWIE
YPSIEATSALMNHSGIATVLATGGAGMVKSAYSTGKPALGVGPGNVPSYIEKTANIKRAV
NDLIISKSFDNGMICASEQAIIVDKEIYAAIKEEFEAHQVYFIKPNELSKLEDAVMNEEK
TAVNPVIVGNSAEVIANLAGIKVPKGTKILVAELEGVGAKYPLSREKLSPILAMIKANNT
EQALDLCEAMLELGGLGHTAVIHTEDEGLQVNFGLRMKACRILVNSPSAEGGIGNIYNEM
IPSLTLGCGSYGKNSVSKNVSSINLINVKTIAKRRNNMQWIKLPRVYFEKNSLQYLQTME
NVERVMLVCDPGMVQFGYADIVVKELQKRANDIKLVTFSEVEPNPSTNTVYAGTKMMREF
EPDTIIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQEFLDIRKRTYKIKKAVKSKLVCIP
TTSGTGAEVTPFAVITDSDTHVKYPLADYALTPDVAIVDPQFVLSVPASVTADTGMDVLT
HAIESYVSVMASDYTRGLSLQAIKLVIENLEKSVNTADMEAREKMHNASTMAGMAFANAF
LGITHSIAHKIGGEYNIPHGRTVGILLPHVIRYNATDPSKHAMFPKYDYFRADTDYADIA
KFIGLKGKDTAELVEALATTVYELGQKVGIKMNLKDQGVTKAVLDSTVDRMAELSYEDQC
TTANPKEPLISELKQIIINAYNG
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagcgaaaaaagaggtaggacaagaaatggatattcaaacaatgattaatgaa
ttggcaggcaaggcaaatgtggctttgaaagaaatggcaaatttcgatcaagaaaaagtt
gatcatattgttcatcaaatggcaatagctgcattggatcaacatatgcaattggcaaaa
ttggcagtagaagaaactggtcgaggtattgttgaagataaagcaattaaaaatatttat
gcttctgaatatatatggaatagtatcaaaaataataaaacggttggtattatcaatgaa
gatgaccaaactggtttaatcgaaatagcagaaccagtaggtgtcatttgtggtgttacg
ccaacaacgaatcctacatcaacgactatttttaaatctttaattgccttaaaaacacga
aatccaattatttttgcttttcatccaagtgcacaacaatgttcaaagaaagcagccatg
attgttagagattcagcaattcaggcaggagcaccagaaaattgtgttcaatggattgaa
tacccatctattgaagctacttctgcattgatgaatcactcaggtatagctaccgtgttg
gctacagggggagctggtatggtaaaatctgcttattcaactggaaaaccagctttggga
gttggacctggaaatgtcccttcctatattgaaaaaacagcaaatattaagcgtgccgtt
aacgatttgattatttcaaaatcatttgataatggaatgatttgtgcttcagaacaagca
attattgtagataaagagatttacgcagctattaaagaagaatttgaagcacaccaagtt
tattttattaaaccaaatgaattaagtaaactagaagatgctgtaatgaatgaagaaaaa
acagctgtaaatccagtaattgtaggtaattctgctgaggtaattgccaatttagcaggc
atcaaggtaccaaaaggaacaaaaattttagttgctgaattagaaggtgttggagcgaaa
tatccattatcacgtgaaaaactatctcctatccttgctatgataaaggcaaataataca
gaacaagcgcttgatttatgtgaagcaatgctagaattaggtggattaggacatacagca
gttattcatacagaagatgaaggattgcaagttaactttggtttacgaatgaaagcttgt
cgtatcctggttaattctccttcagcagaaggtggtataggaaatatttataatgaaatg
attccatctttaactttaggttgtggttcatatggaaagaattctgtttctaaaaatgtt
tcttctattaacctaattaacgttaaaacaattgcgaaacggagaaataatatgcaatgg
attaaattaccacgagtttactttgaaaaaaactctttacaatatttacaaacaatggaa
aatgttgaacgagtaatgctggtttgtgatcctggaatggttcaatttggatatgcagat
atagtagtaaaagaattgcaaaaacgtgctaacgatataaaacttgttactttttctgaa
gttgaaccaaatccatcaaccaatactgtttatgcgggtactaagatgatgagagaattt
gaaccagacacaattattgccttaggtggtggttcagcaatggatgctgcaaaaggtatg
tggatgttctatgaacacccagacacttcattctttggtgcaaaacaagaattcttagat
attcgtaaacgaacgtacaaaattaaaaaagccgtgaaatcaaagctcgtttgtattcct
acaacttccggaacaggggcagaagtaacgccatttgctgtaattactgatagtgataca
catgtaaaatacccattagcagattatgcattaacacctgatgtagctattgttgatcca
caatttgttttatctgtacccgcttctgtaactgcagatactggaatggatgtcctaact
catgccattgaatcttatgtctcagtcatggcttctgattacacacgtggactcagtcta
caggcaattaaattagttatcgaaaatttagaaaaatccgtaaatacagcagatatggaa
gcacgtgaaaaaatgcataatgcttcaacaatggctggtatggcatttgcaaatgcattc
ttgggaattactcattctattgcacataaaattggtggagaatataatattccacatggt
cgtactgtaggtatattattgcctcatgtgattcgttataatgcaactgatccatcaaaa
catgcaatgtttcctaaatatgattactttagagcggatacagattatgctgatattgct
aaattcattggattaaaaggaaaggatactgctgagttggttgaagccctggcaacaacg
gtttatgaacttggtcaaaaagttggaatcaaaatgaacttaaaagatcaaggtgtcaca
aaagcagtacttgattctactgttgatcgaatggcagaattatcttatgaagatcaatgt
acaactgccaatccaaaagaaccattaattagtgaattaaaacaaattattattaatgcc
tataacggttaa

DBGET integrated database retrieval system