KEGG   Melissococcus plutonius ATCC 35311: MPTP_0934Help
Entry
MPTP_0934         CDS       T01492                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPTP_0934
   00052 Galactose metabolism
    MPTP_0934
   00500 Starch and sucrose metabolism
    MPTP_0934
   00520 Amino sugar and nucleotide sugar metabolism
    MPTP_0934
Enzymes [BR:mps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPTP_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980036..980944
Genome map
AA seq 302 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAK
RPIEDHFDANFELESNLRQKNKTDLLKLVEETTDVNLHFIRQSHPMGLGHAVLQAKAFVG
NEPFIVMLGDDIMKDKIPLSKQLMNDYENTHASTIAVMKVPHMETSKYGIIDPEQEIAKG
LYNVHNFVEKPKPENAPSDLAIIGRYLLTPEIFEILETQKPGAGNEIQLTDAIDTLNRTQ
RVFAREFVGKRFDVGDKFGFLKTSIEYGLVHPEVKDNLRQFIIDTGIQLSKEDKTKKTDN
KS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagccgttattccagcagcaggattaggtacccgttttttacctgca
accaaagcaatcgctaaggaaatgttaccaattgttgacaaaccaacgattcaatttatt
gttgaggaagctttagcttcaggaattgaagatatcttaattgtaactggaaaagctaaa
cgaccaattgaagatcatttcgatgcaaattttgagttagaaagtaatttacgacaaaaa
aataaaacagacctattaaaattggtggaagaaacgacagatgtaaacttacattttatt
cgtcaatctcatcctatgggactaggacatgctgtacttcaggcaaaggcttttgttgga
aatgagccatttattgttatgcttggtgatgacatcatgaaagataagataccattatca
aaacaactaatgaatgattatgaaaatacacacgcatcaacaattgctgttatgaaagtt
ccccatatggaaacttcaaaatatggaattattgatcctgagcaggaaattgctaaggga
ttatataatgttcataattttgttgaaaaaccaaaacctgaaaacgcacctagtgattta
gcaattattggtcgttatttactgacgcctgaaatatttgaaattttagaaacacaaaaa
cccggagctggaaatgaaattcagttaactgatgccattgatacattgaacagaacgcaa
cgtgtatttgccagagagtttgtgggtaaacgatttgatgttggtgataaatttggcttt
ttaaaaacaagtattgaatatggccttgttcatccagaagtaaaagataacttgcgtcaa
tttattatcgatacaggaattcaattatccaaagaagacaaaacaaaaaagacagataac
aaatcataa

DBGET integrated database retrieval system