KEGG   Melissococcus plutonius ATCC 35311: MPTP_0947Help
Entry
MPTP_0947         CDS       T01492                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPTP_0947
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_0947
   00020 Citrate cycle (TCA cycle)
    MPTP_0947
   00620 Pyruvate metabolism
    MPTP_0947
Enzymes [BR:mps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MPTP_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995527..996849
Genome map
AA seq 440 aa AA seqDB search
MTYQFKLPDIGEGISEGEIAKWFVKPGDIIKEDDTLLEIQNDKSVEEIPSPVTGTVKTIL
VSEGSVANVGDVLVEIDAPGHNATNVSSSNSTQSEKQDVNSNSVKNTEEKSVQSKTTSLS
TNDSTKQVLAMPSVRQYAREKEVDIKQVSPTGKGGRVTKADIDTFISGGGQENTATSQEI
TTQLETNQAEESTNQSATSMIATEMAQSETREKMTPTRKAIAKAMVHSKQTAPHVTLHDE
VEVSKLWEHRKKFKTIASEYGTKLTFLPYVVKALTATVQKFPVLNASIDDATQEIVYKNY
YNIGIATDTENGLYVPNIKNANTKSMFAIAAEINEKAEAAQQGKLTAQDMKAGSITISNI
GSVGGGWFTPVINYPEVAILGVGTITQQPIVNTEGELAVGRVLKLSLSFDHRIVDGATAQ
KAMNNIKRLLADPELLLMEG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaatttaaattaccagatattggagaaggaatttcagaaggcgaaattgca
aaatggtttgtcaaaccgggcgatattattaaagaagatgatactttactagaaattcaa
aatgataaatccgtagaagagataccatcacctgttactggaaccgtcaaaacgatcttg
gtttctgaaggatcggtggcaaatgttggcgatgttctagtagaaattgatgcaccgggt
cataatgctactaatgtttcatcatcaaattcaacacaatcggaaaaacaggatgttaat
agtaactcggttaaaaatacggaagaaaaatcagttcaatctaaaacaacttccttatca
acaaatgattcaactaaacaagtattagctatgccctctgttcgccagtatgcacgtgaa
aaagaggtagatattaagcaagtttcaccaactggaaaaggtggacgggtcactaaagct
gatattgatacttttatttcaggcggtggacaggaaaatacagcaacttcacaagaaata
acaacacaactggaaacaaatcaagcagaagaaagtacaaatcagtcagctacatcaatg
atagctactgaaatggctcaatctgaaactcgtgaaaaaatgacacctactagaaaagcg
attgccaaggcaatggttcatagtaaacaaacagctcctcacgttacattacacgatgaa
gttgaagtatcaaaactttgggaacatcgtaagaaatttaaaaccattgcttctgaatat
ggaacaaaattaactttcttgccctatgttgttaaagcactaacagctactgtacaaaaa
ttccctgtattaaatgcttcaattgatgatgctacccaggaaattgtctataaaaactat
tataatattggtattgcaactgacacagaaaatggattgtatgtaccaaatataaaaaat
gcgaatacaaaaagcatgtttgcaattgctgctgaaattaatgaaaaagcagaagcggca
caacaaggaaaattaactgctcaggatatgaaagcaggatcaattacgattagtaatatt
ggttctgtaggtggtggttggtttacaccggtcatcaattatccagaagttgctattttg
ggtgttggtacaattacccaacaaccaattgtaaatacagaaggtgaacttgccgtaggt
cgtgtattgaaactctccttaagctttgatcatcgaattgttgatggagcaacagcacaa
aaggcaatgaacaatattaaacgcttattggctgatccagaattattattaatggaaggg
tga

DBGET integrated database retrieval system