KEGG   Melissococcus plutonius ATCC 35311: MPTP_1016Help
Entry
MPTP_1016         CDS       T01492                                 

Definition
xylulose-5-phosphate phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MPTP_1016
Enzymes [BR:mps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MPTP_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1080756..1083155
Genome map
AA seq 799 aa AA seqDB search
MEKDKYSSTEYLDKIDKWWRAANYLSIGQLYLKDNPLLKRKIRSEDVKYHPIGHWGTIAG
QNFIYAHLNRIINKYDLNMFYIEGPGHGGQVMVSNSYLDGSYTEIYPAVTEDEAGMQKLF
KRFSFPGGVSSHAAPETPGSIHEGGELGYSLSHGVGAILDNPEVISAVVIGDGESETGPL
ATSWFSNTFINPVTDGAVLPILHLNGAKIANPTILGRKSDKELEQYFRGMGWIPYFVEGN
DPNQMHPLMAKTLDQVIEKIHSIQETARKQTAETASIQKWPLIVLRTPKGWTGPKEWDGK
PIEVTFRAHQVPIPIDQDHMEHVDQLVNWLKSYKPEELFDETGRLNSEIRAIAPMNDKRM
AMNPITNGGINPKPLQMPDWREFDLHISKPGELVAQDMLEFGKMVAAIIKKNPQNFLIFG
PDETKSNLLNDAFSVTSRQWLEPIYEPQDEWLAPSGRIIDSQLSEHQDEGILEGYVLTGR
HGFFASYEAFIRIVDSMIAQHIKWMRKAMDLPWRNGYSSLNLIASSTAFQQDHNGYTHQD
PGILSHLAEKEADFIHEYVPADTNSLLAVMDKVLKSQGKVNLVISSKHPRPQFYSPEEAQ
ELVNRGLMEIDWASTVAENGTPEIVIVAAGTEPNMEALAAINLINQSFPKLQFRFINVVD
LLKLRHPAVDSRGISEVEYNHLFTVDSPIIFVCQGYSSLIRSLFYDRKNRPVSIHSYQEN
GAITTPFDMRVLNKIDRYHLAKDIALTAYGSRGEDFARAMDTILEKHNQYIRETGKDLPE
VLNWKWAPLHIYNENIEQD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagataaatactcttcaactgaatatttggataaaatagataaatggtggcgg
gcagcaaattatttatctataggacaactgtatttaaaggataatccattattaaagagg
aaaattcgctcagaagatgtgaaatatcatccgattggacattggggaacaatcgcaggt
cagaatttcatttatgctcatttaaatcgtattattaataaatatgatttaaatatgttt
tatattgaaggaccaggtcatggtgggcaagttatggtatccaattcttatcttgatgga
agttatacagaaatatatcctgctgtgactgaagatgaggctggaatgcaaaaattattc
aaacgtttttcatttcctggtggtgtttcctctcatgctgcacctgaaacacctggttcg
attcatgaaggtggagaacttggatattcactatctcatggcgtaggagctattttagat
aatcctgaagtcatttctgctgttgttattggtgatggagagtcagaaacaggtccacta
gcaacctcatggttttcaaatacctttattaatccagtaacagatggggcagttttgccc
attctacatttaaatggtgcaaaaattgctaatccaacgattttgggtagaaaatcagat
aaggaattagaacaatatttcagaggaatgggatggattccctattttgttgaaggcaat
gatcctaatcagatgcatccactgatggctaaaacgctcgatcaagttattgaaaaaatt
cattccattcaggaaacagcaagaaaacaaactgctgaaacagcaagcattcaaaaatgg
ccgctcattgttttacgcacaccgaaaggttggactgggccaaaagaatgggacggaaaa
ccaatcgaggtaacgtttagagctcatcaggtgcctataccaattgatcaagatcacatg
gaacatgtcgatcaattagtgaactggttaaaatcttataaacctgaagaattatttgat
gaaacaggtagattaaactctgaaattcgggcaattgctccaatgaatgataaacggatg
gcaatgaatcctattacaaatggtggcattaatcctaaaccactacaaatgccagattgg
cgagagttcgatcttcatatttcgaaaccaggagaacttgttgctcaagatatgttggaa
tttggtaaaatggttgcagcaattataaagaaaaacccacaaaattttctaatctttggg
ccagatgaaacaaaatctaatctcttaaatgatgcatttagtgtaacaagtcgtcagtgg
ttagaacccatctatgaaccacaagatgagtggttagcaccaagcggtcgaatcattgat
agccagttatctgaacatcaagatgaagggattctagaaggctatgtgttaacaggtaga
catggtttctttgctagttatgaagcattcattagaattgttgattcaatgattgctcaa
catattaaatggatgagaaaagccatggatttaccttggcgaaatggatattcatcatta
aatctaattgcatcgtcaactgcttttcagcaagatcacaatggttacacccatcaagat
cctggtatattatctcatttagctgaaaaagaagcagactttattcatgaatatgttcca
gcagatacaaatagtctattagcagttatggataaggtattaaaaagtcagggaaaagtc
aatctggttatttcaagtaaacatccacgaccccaattttattctcctgaagaagcacaa
gaattagtaaatagggggttaatggagattgattgggcaagtacagtggcagagaatggc
acaccagaaattgtcattgttgctgctggaaccgagccaaatatggaagctctagctgcc
ataaatctaattaatcagtcatttccaaaattgcaattccgatttattaatgttgtcgat
ttattaaaattaagacatccagcagttgattcaagaggaatttctgaagtagaatataat
catttatttacggtagatagtccaattatatttgtttgccaggggtatagtagcctgatt
cgttcactgttttatgatcgaaagaatcgtccagtctctattcatagttatcaagaaaat
ggtgcgattactactccttttgatatgcgggttcttaacaaaattgatcgctatcattta
gcaaaggacattgctttaacggcctatggttctagaggagaagattttgctagagcaatg
gatactattttagagaaacataaccaatacattcgcgaaacaggaaaagatttaccggaa
gttttaaactggaaatgggcaccacttcatatttataacgaaaatattgaacaagattaa

DBGET integrated database retrieval system