KEGG   Melissococcus plutonius ATCC 35311: MPTP_1160Help
Entry
MPTP_1160         CDS       T01492                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mps00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mps00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238674..1238985)
Genome map
AA seq 103 aa AA seqDB search
MEVASILHMGAEIYFSGPPEWYDKQFDAYGQYRLLDGIIEEIDVVMLLRVQHERHDGSEL
FSKETYHREYGLTIERAKKLPKKAIIMHPAPVNRDVELADQLV
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggccagcatcctacacatgggagcagaaatttacttttcaggtccaccagaa
tggtatgacaaacaatttgatgcttacggacaatatagactattagatggaattattgaa
gagattgatgttgttatgcttttacgagttcagcatgaacgacatgacggttcagaatta
ttttcaaaggaaacttatcatagagaatatggcttaacaattgaacgtgcaaaaaaattg
cctaaaaaagcaattattatgcatccagcacctgttaatcgagatgtagaattagcagac
caacttgtatag

DBGET integrated database retrieval system