KEGG   Melissococcus plutonius ATCC 35311: MPTP_1160Help
Entry
MPTP_1160         CDS       T01492                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MPTP_1160
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPTP_1160
Enzymes [BR:mps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MPTP_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238674..1238985)
Genome map
AA seq 103 aa AA seqDB search
MEVASILHMGAEIYFSGPPEWYDKQFDAYGQYRLLDGIIEEIDVVMLLRVQHERHDGSEL
FSKETYHREYGLTIERAKKLPKKAIIMHPAPVNRDVELADQLV
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggccagcatcctacacatgggagcagaaatttacttttcaggtccaccagaa
tggtatgacaaacaatttgatgcttacggacaatatagactattagatggaattattgaa
gagattgatgttgttatgcttttacgagttcagcatgaacgacatgacggttcagaatta
ttttcaaaggaaacttatcatagagaatatggcttaacaattgaacgtgcaaaaaaattg
cctaaaaaagcaattattatgcatccagcacctgttaatcgagatgtagaattagcagac
caacttgtatag

DBGET integrated database retrieval system