KEGG   Melissococcus plutonius ATCC 35311: MPTP_1341Help
Entry
MPTP_1341         CDS       T01492                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPTP_1341
   01230 Biosynthesis of amino acids
    MPTP_1341
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_1341
   00030 Pentose phosphate pathway
    MPTP_1341
   00051 Fructose and mannose metabolism
    MPTP_1341
   00052 Galactose metabolism
    MPTP_1341
  Energy metabolism
   00680 Methane metabolism
    MPTP_1341
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MPTP_1341
Enzymes [BR:mps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MPTP_1341
Protein phosphatases and associated proteins [BR:mps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MPTP_1341
Messenger RNA biogenesis [BR:mps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MPTP_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1417186..1418148)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVVRKGIYDKIEVYGINYGYAGLVAGDIRRLDVSDVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVVGGDGSYQGALALTKRGFPAI
GIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWS
GVAGGADEIVIPEHNFDMASVAKRIQEGRDRGKKHCLIILAEGVMGGHEFAEKLSDFGDF
HTRVSILGHMVRGGSPSARDRVLASKFGAYAVELLEQGRGGLCVGVVDNKMVSSDIIDTL
KNKHHDPDMSLYGLNQQISF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagcggtggcgatgcaccaggaatgaatgctgcaatt
cgggcagttgtccgaaaaggaatctatgacaaaatagaagtttacggaatcaattatggg
tatgcaggattagttgctggtgatattcgtcgtttagatgtttctgatgttggtgacaag
attcaacgaggaggcacctttttatactctgctcgttacccagaatttgcaactgaagaa
gggcaattaaagggaattgagcaattaaaaaaatttggtattgaaggattggtcgttgta
ggcggtgatggttcctatcagggagcacttgctttgacaaaacgcgggtttccagcaatt
gggattccaggaacaatcgataacgatattccaggtacagattttacaattgggtttgat
acagctattaatacggttcttgaatcgattgatagaattcgcgatactgcaacttctcat
gtacgcacatttgttattgaggtgatgggaaggaatgcaggagacattgctttatggtct
ggtgttgctggcggtgcagacgaaattgttattcctgaacataactttgatatggcttct
gtagcaaaacgtattcaagaaggacgagatcgtggtaagaagcattgtttaattatccta
gcagaaggcgtaatgggcggacatgaatttgcagaaaaactttctgactttggtgatttt
cacacaagagtttccattttaggtcatatggttcgtggtggttctccaagtgctcgcgat
cgtgttctagccagcaaatttggcgcatatgcggttgagcttcttgaacaaggaagaggc
ggtctatgtgttggtgttgtcgacaataagatggtttcatcagacattattgatacactt
aaaaacaagcaccatgatccagatatgtccttatatggattaaatcagcaaatatctttt
taa

DBGET integrated database retrieval system