KEGG   Melissococcus plutonius ATCC 35311: MPTP_1548Help
Entry
MPTP_1548         CDS       T01492                                 

Definition
proposed amino acid ligase found clustered with an amidotransferase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MPTP_1548
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MPTP_1548
Enzymes [BR:mps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     MPTP_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1591423..1592781
Genome map
AA seq 452 aa AA seqDB search
MNVRSSIAVAAGKTSQWFLQTFLKGGSSYPGKLALKIDPKILDTLAKDYETIIVTGTNGK
TLTTALIVNILKQEFGDVLTNPTGANMEQGIVSTFLGAKKTHQQKKFAVLEIDEASLSHV
TKYIKPQTFVFTNIFRDQMDRYGEIYTTYRLILEGAKAAPEALIICNGDSPIFNSTDTMN
PRSYYGFNHLPDKDQAAHYNTDGLLCPKCQHILNYKMITYANLGKYYCSNCGFHRPQLDV
SLTAINQMDNHSSDFTIDGSTYHIPVVGMYNIYNALAATAVATHYHISAEKIRTGLKDND
EIFGRQETIQIGDKECTLILVKNPVGLNQVIDMIGLTQTSFSLVSLLNANYADGIDVSWI
WDGNQEAFATMNIPAVIAGGDRHQDMSLRLKVAGIPEEKIKEISSLDTVIDEIKKLPTKN
VYILATYTAVLQLRKLLTDKKYIQGGMSGAKK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtacgtagttccatcgctgttgccgctggtaaaacttcccaatggtttttacaa
acctttcttaagggtggaagtagttatcctggtaaattagcattaaaaatagatccaaaa
atcttggatactctagcaaaagactatgaaacaattattgtaacaggcaccaatggaaaa
acattgacaacggcattaattgtaaatattttaaaacaagaatttggtgatgttttaaca
aacccgacaggtgcaaatatggaacaagggattgtttcaactttccttggtgctaaaaaa
acacatcaacaaaaaaaatttgcagtattagaaatcgatgaagcaagcttaagtcatgtg
acaaaatatattaaaccacagacatttgtattcacaaacattttcagagatcaaatggat
cgctatggagaaatttatactacttatcgtttgattttagaaggtgcaaaggctgcacca
gaagcactaattatctgtaatggtgattcaccgatttttaattcaacagatacaatgaat
ccaagaagttattatggatttaaccatttaccagataaagatcaggctgcccattacaat
acagatggtttactatgtcctaaatgtcagcatatccttaattacaaaatgattacttac
gccaatcttggaaaatactattgttcaaattgtggttttcatcgtcctcagttagatgtt
tcattaacagctatcaatcagatggataatcattcttctgattttaccattgatggttca
acctatcatattccagtggtcggtatgtataatatttataatgctttggctgccacagcc
gttgcaacacattaccatatttcagctgagaaaattaggactggtttgaaagataatgat
gaaatctttggtagacaggaaacaattcagattggtgataaagaatgtacattaatttta
gttaagaatcctgtaggattgaatcaggtcattgatatgattggtttaacgcaaacatct
ttctcactcgtctctttactaaatgcaaattatgctgacggtattgatgttagctggatt
tgggatggaaatcaggaagcatttgctacaatgaatattccagctgtcattgcaggtggt
gatcgtcatcaagatatgtctttacgtctaaaggtcgctggaattcctgaagaaaaaata
aaagaaatctcctcattagatacagtcattgatgaaattaaaaaattgccaacaaaaaat
gtttatattttagctacctatacagcagtgttacaattacgcaaattgcttacagataaa
aaatatattcaaggaggaatgagtggtgccaaaaaataa

DBGET integrated database retrieval system