KEGG   Melissococcus plutonius ATCC 35311: MPTP_1575Help
Entry
MPTP_1575         CDS       T01492                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
mps  Melissococcus plutonius ATCC 35311
Brite
Enzymes [BR:mps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MPTP_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 DLH Peptidase_S9 Abhydrolase_1 PGAP1 Esterase DUF2048 BAAT_C Abhydrolase_2 SAM_2 Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: BAK22003
UniProt: F3YBX5
Position
complement(1617952..1618707)
Genome map
AA seq 251 aa AA seqDB search
MNRTKQLPKSLFTENGSRSVLLLHAYSGSSNDVRLLSRFLEKEGYTVYAPNFSGHGTLIP
EDILNRSPEDWRQETLDAIQFLYNKGYEQIAILGLSMGGLFAMDALTKNIDSLIGGGSFC
SPIYPCENHVPENFMLYAEQLLIKHNLSTSEIQYRLAEIKPRMLEQLKWLESFSKKITDQ
LSEITRPVFIAQSGCDQMIDRNGSFHTIKKLTQIPFTLQWYPDSGHVITTGPEHKKLEKD
VLHFLTTLSWN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagaacaaaacaattaccaaaatccctatttacagaaaatggatctagatcggtg
ttattattgcatgcctattctggtagcagcaatgatgttcgattgttgagtcgcttttta
gaaaaagaaggctatacagtgtacgcaccgaacttttctggacatggaacattgatacca
gaagatattcttaatagatcgccagaagattggcgacaagaaacattagacgccattcaa
tttctttataataaggggtatgagcagatagcaattttgggtctatcaatgggtggatta
tttgcaatggatgcattaaccaaaaatatcgatagtttaataggtggtggttctttttgt
tcccctatttatccttgtgaaaatcatgttccagagaactttatgttatatgcagaacag
ttattgataaaacataatttatcaaccagtgaaatacagtatcggttagcggaaataaag
cctcgcatgcttgaacagttaaaatggcttgaatcattttcaaaaaaaattacagatcaa
ttatcagaaattacacgaccggtttttattgcacaatctggttgtgatcaaatgattgat
aggaatggtagttttcacacaattaagaaattaacgcagatacctttcactttacaatgg
tatccagatagtggtcatgtcattactacaggccctgaacataaaaaactagaaaaagat
gttttgcattttttaacaacattatcttggaattga

DBGET integrated database retrieval system