KEGG   Melissococcus plutonius ATCC 35311: MPTP_1605Help
Entry
MPTP_1605         CDS       T01492                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MPTP_1605
Enzymes [BR:mps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MPTP_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649865..1652447)
Genome map
AA seq 860 aa AA seqDB search
MDLLFDGEKAYIVGSVKAIFFENPTNFYKVLLIQLTETNTDFLEKEIVVTGSFGQIQEEE
LYRFYGHFVDHPRYGRQFQVDSYQKEKPTSMNGVINYLSSDKFPGIGRRTAEKIVEVIGK
DTIDQIIAHPETLKQVPNLNEKKRQVIIEGIQLNHGMEQIIVGLNQYGFGNQLSFTIYQV
YKEETLEVIKKNPYQLVEDIEGIGFKRADAIADQLGMTADSTTRIQAAILHVLFQQSIQT
GNTYVKAEILLEETIELLEKSRPIEISHDQVAAQIIELVQKGKIQQETTELFNNSLYFAE
WGIGTSIQRLLAQKKETTYEAAKIKDSLRLLEKQLNISYGKIQQKAIKLAIKSPLFILTG
GPGTGKTTVINGIVSLFAELNGISLDLKDYTQKTFPILLAAPTGRAAKRMNEMTGLPAST
IHRLLGLTGREKNPGITAKELEGGLLIIDEMSMVDTWLANTLFKNIPTNMQVILVGDKDQ
IPSVGPGQVFYDLLQVDEIPKIELTKIYRQETDSSIIELAHEIKQGKLPENLTINQKDRS
FFRSDAFHIEHYIKQIISKATAKGFTAQDIQVLAPMYRGAAGINALNKMMQGIFNPADGK
KKEVTFGETTYRIGDKVLQLVNMPETNVFNGDMGEIVGIVPAKESDDKVDELVIQFDTNE
VSYKRNEWNKITLSYCCSIHKAQGSEFKMVILPMIHQYNRMLQRNLLYTAITRSKELLIL
LGEPEAFQQCVENEAATRLTRLKECIQRADTMTVSERLKLEAFEESLVNSSPFGEKQVTD
NKNDIEFTKNANKSANKLLTKETLTQPKSEVETISLFSEPSESKIQESKPHLLTMALIQA
NTIDPMIGMDGITPDQFVKN
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggatttgctttttgatggggaaaaagcctacattgttggtagtgtaaaagccatcttt
tttgagaatcccaccaatttctataaagtattattgattcaactgacagagacgaataca
gattttcttgaaaaggagattgtagtaacaggtagttttggtcaaattcaggaagaagaa
ctttatcgtttttatgggcattttgttgatcacccacgttacggacgacaatttcaagta
gatagttatcaaaaagaaaaaccaacatcgatgaatggtgtcattaattacctatcaagt
gataagtttcctggaattggtagacgaacagcagagaaaattgttgaagttatcggcaaa
gataccattgatcaaattattgctcatccggagactttaaagcaagttccaaatcttaat
gaaaaaaaacgtcaagtaattattgaaggaattcaattaaatcatggtatggaacaaatt
attgttggattgaatcaatatggatttggaaaccagctctcctttactatttatcaagta
tataaggaagaaacgctggaagttattaaaaaaaatccttatcagttagtagaagatatt
gaaggaattgggttcaagcgtgcagatgccattgcggatcaattgggaatgacggcagat
tcaacaacacgtattcaggcagcgatccttcatgtactttttcagcaatctatccaaacg
ggaaatacctatgtaaaagcagaaattttattagaagaaaccatcgaattattagagaaa
agtcgtccaatagaaatctcacatgatcaagtagcagcacaaatcattgagttagttcaa
aaaggaaaaatacagcaagaaacaaccgaattatttaataatagtctttattttgctgaa
tggggcattgggacttctattcagcgtttgttagctcaaaaaaaagaaacaacctatgaa
gcagccaaaataaaagattctctaagattacttgaaaagcaattaaatatctcttacgga
aaaatacagcaaaaggcgataaaactagcgattaaatctcccttatttatcctaactggt
ggaccaggtactggaaagacaaccgtcattaatggaattgtttcgctttttgcagaatta
aatggtatttctttagatttaaaagactatacacaaaagacatttccaattttgctggct
gcaccgactggcagggctgcaaaacgaatgaacgaaatgacaggattgcctgctagcacc
attcatcgtttactaggattaacaggtcgagaaaaaaatccaggaataacagcgaaagaa
ctagagggcggtttgttaatcattgatgaaatgtctatggtggatacttggttagccaat
acattatttaaaaatattcctactaatatgcaggtaatacttgttggtgataaggatcag
attccatccgtaggaccaggacaagttttttatgatctattgcaagtagatgaaattcct
aagattgaattaacaaaaatttatagacaagaaactgattcaagtattatcgaactagct
catgaaattaaacaaggtaaactaccagaaaacttaacgattaatcaaaaggatcgctcc
ttttttaggagtgatgcatttcatatcgaacattatataaagcaaatcattagtaaagca
acagcaaaaggttttacagcacaagatattcaggttcttgcaccaatgtatcggggagca
gctggcattaacgcacttaataaaatgatgcaaggtatttttaatccggcagatggcaaa
aagaaagaagttacgtttggagaaacaacctatcgtattggtgataaggtacttcagttg
gtaaatatgccagagacaaatgtttttaatggggatatgggtgagattgtcggcattgta
ccagcaaaagaatctgatgataaagtagatgaattggttattcaatttgacacgaatgaa
gtaagttataaacgaaatgaatggaacaaaattacattatcgtattgttgctccatccat
aaagcacaaggtagtgaatttaaaatggttatcctaccgatgattcaccaatacaatcgg
atgctacagcgcaatctgctttatacggctattactcgtagtaaggaattattaatttta
ttaggcgaaccagaagccttccagcagtgtgttgagaatgaggcagctactcgtttaact
cgtcttaaagaatgtattcaaagagcagataccatgacagtttctgaacgcttgaaatta
gaagcgtttgaagaaagcttagtgaattcctcaccatttggtgaaaaacaagttaccgat
aataaaaatgatatagaatttacaaaaaatgctaacaaatctgcaaataaactgctgacg
aaagaaacattgacccaaccaaaatctgaggttgaaactatttccttattttctgagcca
tcagaatcaaaaattcaagaatcaaaacctcatttactaactatggcattaattcaagca
aatacaattgatccaatgataggaatggatggaataactcctgatcaatttgtcaaaaat
tag

DBGET integrated database retrieval system