KEGG   Melissococcus plutonius ATCC 35311: MPTP_1711Help
Entry
MPTP_1711         CDS       T01492                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPTP_1711
  Amino acid metabolism
   00300 Lysine biosynthesis
    MPTP_1711
Enzymes [BR:mps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MPTP_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1761078..1762496)
Genome map
AA seq 472 aa AA seqDB search
MTIDWKKEVELRKDAMLEDLENLLRINSERDDSKATPDAPFGPGPKEALLHMLSYGERDG
FTVKNVDNYAGHIEYGEGEETLGIFAHMDVVPASAGWTTNPYEPMIKDGKIYARGASDDK
GPSIAAYYALKIIKDLGLPISKRIRFVIGSDEESGWGDMDYYFKHEATPDFGFSPDAEFP
IINGEKGNGTIRLNFRNENQGEYILNSFKSGLRENMVPNTAIAKLVVASEQAALEMQAAF
DIYVKEQPISGTIEIDGKKITIELSGKGAHGAAPQTGINAGTFLAFFLDGYAFGGGAKDF
IHTLAAYIHEDFYGEKLGVAFEDTKMGSLTMNAGIIDFDVDNNSENNNLVTLNFRYPQGT
TLDELQQKVQKTVGDSVKTSQGSHNMAPHYVPTDDPLVKTLLQVYEDHTGQKGEEKIIGG
GTYGRLLKRGVAYGAMFPGYVDTMHQANEFMELEDLFKSAVIYADAIYRLVK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgactggaaaaaggaagtagaacttcgtaaagatgccatgcttgaagatcta
gagaacctcttacgtattaatagtgagcgtgatgattcaaaagcaacaccagatgcacct
tttggtcctggtcctaaagaagctttacttcacatgttatcttatggtgaacgtgatgga
tttactgtaaaaaatgttgataattatgctggacatattgaatatggtgaaggagaagaa
acattaggcatttttgctcatatggatgtggtacctgccagtgcaggttggacaaccaat
ccttatgaacctatgattaaagatggtaaaatttatgctcgtggtgctagtgacgataag
ggaccaagtattgctgcttattatgcactgaaaattattaaagatttaggattaccaatc
tcaaagagaattcgtttcgttattgggagtgatgaagaaagtggttggggtgatatggat
tattacttcaaacatgaagctactccagattttggtttctcaccagatgctgaatttcca
attattaatggagaaaaaggaaatggcacgattcgtttaaattttaggaatgaaaatcaa
ggtgaatatattttaaatagctttaaatctggcttacgagaaaatatggtacctaataca
gcaattgctaagttagtggttgcttctgaacaagctgctttagaaatgcaagctgctttt
gatatctatgttaaagaacaacctatttctggaacgattgaaatagatggtaaaaaaatt
actattgaactatctggaaaaggagctcatggtgctgcgccacaaacaggaatcaatgct
gggacatttttagctttctttttagatggctatgcatttggcggtggtgcgaaagacttt
attcatacgctggctgcttatattcatgaagatttttatggtgaaaaattaggtgttgct
tttgaagatactaaaatgggtagtttaacaatgaatgctggtattattgatttcgacgtt
gataataattctgaaaataacaatcttgttaccctaaatttccgttatcctcaaggaaca
accttagatgaattgcaacaaaaagtccaaaaaacagtaggagattcagtaaaaacaagt
cagggttctcataatatggcacctcactatgtaccaactgatgatccattggtgaaaact
ttattgcaagtttatgaagatcatacaggtcaaaaaggtgaagaaaaaattatcggtggt
ggtacttatggccgcctactaaaacgtggtgttgcttatggtgctatgttcccaggctac
gtagacacaatgcatcaagcaaatgaatttatggaattagaagatttatttaaatcagca
gttatttatgcagatgccatttatcgcttggttaaataa

DBGET integrated database retrieval system