KEGG   Melissococcus plutonius ATCC 35311: MPTP_1903Help
Entry
MPTP_1903         CDS       T01492                                 

Definition
beta-hexosamidase A (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mps00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mps00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMP1:complement(58254..59957)
Genome map
AA seq 567 aa AA seqDB search
MVDLTKKPYCLNKQQINYIEEKIAKMSIDEKVGQLFFVIGQDENMTDIAEFIEKYQPGGM
MYRPDVAEKIKREIATAQTASQVPLFFAANLESGGNGIISEGTWFGMPLQMAATDDPKSA
YELGNVSGFEASQVGCNMSFAPIVDIDKNFRNPITNTRTFGSDKTRVMKMAEAQIKGLEK
NQVIPVIKHFPGDGVDERDQHLVSSVNSLTKDDWMNTYGQIYRQLIETGISSIMIGHITQ
PAWERYLQPDISDKDLRPASSSSLLINGLLRDVLQFNGLAITDATPMIGYNAATDRENLL
PETINAGIDMILFNKNIDEDYHYIRQAVENGKLPIERVNEAIMRILGTKLAQGIMDTNES
LLLTPPETLALDTKAHEKLAEEVEKKAVTLVKDRDHLLPLTPERYPRIRLVILGDSDEGG
FKEGGKVTDLFKMQLEKVGFIVSLYNSQQLDFHEIFEEGVQDMKEKFDLALYIANIETAS
NQTTTRLDWIPLMAANSPWFMQAIPTVFISTANPYHLFDIPSVSTFINAYTGNKASVEAV
MRKITGQEAFEGINPVDPFCGDFTAKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttaacaaaaaaaccttattgcttaaataaacaacaaattaattatattgaa
gaaaaaattgctaaaatgtcaattgatgaaaaggttggtcaattattttttgtcattggt
caagatgaaaatatgacggatattgctgaattcatagaaaaataccaacctggtggtatg
atgtatcgtccagacgtggctgaaaaaatcaagcgtgaaatagcaacagctcaaacagct
agtcaggttcctcttttctttgcagcaaatctagaatctggtggtaatggcattatatct
gaaggcacttggtttggtatgcctcttcaaatggctgcaactgatgatccaaaaagtgct
tacgaattaggtaatgtttctggttttgaagccagtcaagtcggttgtaatatgtctttt
gccccaattgttgatattgataaaaattttagaaatcctattacaaacacacgaacattt
ggtagtgataaaacacgagtaatgaaaatggcagaagctcaaatcaaagggttagaaaaa
aatcaagttatcccagttatcaaacactttcctggagatggtgtggatgagagagatcag
catttagtaagttctgtaaattcattaactaaagatgactggatgaatacttatggacaa
atctatcgtcaacttattgaaacaggtatttctagtattatgattggccatatcacgcaa
cctgcctgggaacgttatttacaacctgatatttccgataaagatttacgaccagcttcc
agttcttctcttttaattaatggattgttgcgagatgttctgcaattcaacggactagcg
attacagacgcaaccccaatgattggttacaatgcagcaacagatcgtgaaaacttactg
ccagaaacaatcaatgcaggaattgatatgattctttttaataaaaacattgatgaagat
tatcactatatcagacaagccgttgaaaatggtaaattgccaatagagcgtgtcaatgaa
gcaattatgcgaattcttggtacaaaattagcgcaaggcatcatggatacaaacgaaagt
ttactgcttacaccaccggaaacattagcattagataccaaagcacatgaaaaattggcg
gaagaagtcgaaaaaaaagctgtgacattggtgaaagatcgtgatcacttgcttccacta
actcctgaaagatacccacgtatccgactagttattttaggagactctgatgagggtgga
tttaaagaaggcggaaaagtcacagatctgtttaaaatgcagttagaaaaagttggcttt
attgtttctctttataattctcaacagttagacttccatgaaatttttgaagaaggcgtt
caagatatgaaggaaaaattcgacttagcgctttatattgcaaatattgaaacagccagc
aatcaaacaactacaagactggattggattcctctaatggcagctaattcaccatggttt
atgcaggcgattcctaccgtgtttatctcaacagcaaatccttatcatttatttgacatt
ccaagtgtttcaacatttattaatgcctatacaggaaacaaagcgagtgttgaagctgtt
atgcgaaaaattactggacaggaagcctttgaaggaatcaatccagtagatcccttctgt
ggtgatttcacagcaaaattataa

DBGET integrated database retrieval system