KEGG   Methylibium petroleiphilum: Mpe_A0159Help
Entry
Mpe_A0159         CDS       T00470                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00620  Pyruvate metabolism
mpt00630  Glyoxylate and dicarboxylate metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01200  Carbon metabolism
Module
mpt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpe_A0159
   00630 Glyoxylate and dicarboxylate metabolism
    Mpe_A0159
Enzymes [BR:mpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mpe_A0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABM93121
UniProt: A2SC32
Position
166878..168464
Genome map
AA seq 528 aa AA seqDB search
MTTLQLPAGLQINAAILPGFETILTPAALELVAKLHRTFEPRRQELLAARVARVKRLDAG
ERPDFLPETKAIREGDWKIAPIPKALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDS
NSPVWANQIQGQINLYKAIRRTLTLGQAGKTYKLNDKIATLQVRPRGWHLDEKHVLVDGQ
RVSGGIFDFALFLFHNAKEQIERGAGPFFYLPKMESHLEARLWNDIFIAAQKEIGLPQGT
IKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKNDRDFCLADRAKVT
MTAPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIIKDKRRDANDGY
DGGWVAHPGLVESAMKEFVDVLGDRPNQIERQKPYTHITAAQLLEFAPEAPITEAGLRMN
INVGIYYLASWLAGNGCVPIYNLMEDAATAEISRSQVWQWIRSPKGVLADGRKVTADMVR
KMVAEELKGIKDAGYEGQTVDRAAEIFEQMSTQDAFAEFLTLPLYEEI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctccaactgcccgccggcctgcagatcaacgcggcgatcctgccgggcttc
gagaccatcctcacgccggcggcgctcgagctcgtggccaagctgcaccgcaccttcgag
ccccgccgccaggaactgctggccgcgcgcgtggcacgcgtgaagcggctcgatgccggc
gagcgccccgatttcctgccggagacgaaggcgatccgcgaaggcgactggaagatcgcg
ccgatcccgaaggcgctggagtgccgtcgcgtcgagatcaccgggccggtcgaggccaag
atggtcatcaacgccttcaattcgggcgctgattcgtacatgaccgacttcgaggacagc
aactcgccggtctgggcgaaccagatccaggggcagatcaacctgtacaaggcgatccgc
cgcacgctgacgctgggccaggcgggcaagacctacaagctcaacgacaagatcgcgacg
ctgcaggtgcgcccgcgcggctggcacctcgacgagaagcacgtgctggtcgacggccag
cgcgtctccggcggcatcttcgacttcgcgctattcctgttccacaacgccaaggagcag
atcgagcgcggcgccggcccgttcttctacctgccgaagatggagtcgcacctcgaggcg
cggctgtggaacgacatcttcatcgccgcgcagaaggagatcggcctgccgcagggcacg
atcaaggcgacggtgctgatcgagaccatcctcgccgcgttcgagatggacgagatcctg
tacgagctgcgcgagcacagcgccgggctgaatgccggccgctgggactacatcttctcg
tgcatcaagaagttcaagaacgaccgcgacttctgcctggccgaccgcgccaaggtcacg
atgacggcgcccttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgc
ggcgcgcccgcgatcggcggcatgagcgcgctgatcccgatcaagaacgaccccgagaag
aacgccatcgcgatggccgggatcatcaaggacaagcgccgcgacgcgaacgacggctac
gacggtggctgggtcgcgcacccgggcctggtcgagtcggcgatgaaggagttcgtcgac
gtgctgggcgatcgcccgaaccagatcgagcgccagaagccctacacccacatcaccgcc
gcgcaactgctggagttcgcgcccgaggccccgatcaccgaggccgggctgcgcatgaac
atcaacgtcggcatctattacctggcgtcctggctggccggcaacggctgcgtgccgatc
tacaacctgatggaggacgccgccaccgccgagatctcgcgctcgcaggtgtggcagtgg
atccgcagtcccaagggcgtgctcgccgacggccgcaaggtcaccgccgacatggtgcgc
aagatggtggccgaggagctcaagggcatcaaggacgccggctacgaaggccagacggtc
gaccgcgcggccgagatcttcgagcagatgagcacccaggatgcgttcgccgagttcctg
acgctgccgctgtacgaagagatctga

DBGET integrated database retrieval system