KEGG   Methylibium petroleiphilum: Mpe_A0159Help
Entry
Mpe_A0159         CDS       T00470                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mpt  Methylibium petroleiphilum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpe_A0159
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpe_A0159
   00630 Glyoxylate and dicarboxylate metabolism
    Mpe_A0159
Enzymes [BR:mpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mpe_A0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
166878..168464
Genome map
AA seq 528 aa AA seqDB search
MTTLQLPAGLQINAAILPGFETILTPAALELVAKLHRTFEPRRQELLAARVARVKRLDAG
ERPDFLPETKAIREGDWKIAPIPKALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDS
NSPVWANQIQGQINLYKAIRRTLTLGQAGKTYKLNDKIATLQVRPRGWHLDEKHVLVDGQ
RVSGGIFDFALFLFHNAKEQIERGAGPFFYLPKMESHLEARLWNDIFIAAQKEIGLPQGT
IKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKNDRDFCLADRAKVT
MTAPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIIKDKRRDANDGY
DGGWVAHPGLVESAMKEFVDVLGDRPNQIERQKPYTHITAAQLLEFAPEAPITEAGLRMN
INVGIYYLASWLAGNGCVPIYNLMEDAATAEISRSQVWQWIRSPKGVLADGRKVTADMVR
KMVAEELKGIKDAGYEGQTVDRAAEIFEQMSTQDAFAEFLTLPLYEEI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctccaactgcccgccggcctgcagatcaacgcggcgatcctgccgggcttc
gagaccatcctcacgccggcggcgctcgagctcgtggccaagctgcaccgcaccttcgag
ccccgccgccaggaactgctggccgcgcgcgtggcacgcgtgaagcggctcgatgccggc
gagcgccccgatttcctgccggagacgaaggcgatccgcgaaggcgactggaagatcgcg
ccgatcccgaaggcgctggagtgccgtcgcgtcgagatcaccgggccggtcgaggccaag
atggtcatcaacgccttcaattcgggcgctgattcgtacatgaccgacttcgaggacagc
aactcgccggtctgggcgaaccagatccaggggcagatcaacctgtacaaggcgatccgc
cgcacgctgacgctgggccaggcgggcaagacctacaagctcaacgacaagatcgcgacg
ctgcaggtgcgcccgcgcggctggcacctcgacgagaagcacgtgctggtcgacggccag
cgcgtctccggcggcatcttcgacttcgcgctattcctgttccacaacgccaaggagcag
atcgagcgcggcgccggcccgttcttctacctgccgaagatggagtcgcacctcgaggcg
cggctgtggaacgacatcttcatcgccgcgcagaaggagatcggcctgccgcagggcacg
atcaaggcgacggtgctgatcgagaccatcctcgccgcgttcgagatggacgagatcctg
tacgagctgcgcgagcacagcgccgggctgaatgccggccgctgggactacatcttctcg
tgcatcaagaagttcaagaacgaccgcgacttctgcctggccgaccgcgccaaggtcacg
atgacggcgcccttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgc
ggcgcgcccgcgatcggcggcatgagcgcgctgatcccgatcaagaacgaccccgagaag
aacgccatcgcgatggccgggatcatcaaggacaagcgccgcgacgcgaacgacggctac
gacggtggctgggtcgcgcacccgggcctggtcgagtcggcgatgaaggagttcgtcgac
gtgctgggcgatcgcccgaaccagatcgagcgccagaagccctacacccacatcaccgcc
gcgcaactgctggagttcgcgcccgaggccccgatcaccgaggccgggctgcgcatgaac
atcaacgtcggcatctattacctggcgtcctggctggccggcaacggctgcgtgccgatc
tacaacctgatggaggacgccgccaccgccgagatctcgcgctcgcaggtgtggcagtgg
atccgcagtcccaagggcgtgctcgccgacggccgcaaggtcaccgccgacatggtgcgc
aagatggtggccgaggagctcaagggcatcaaggacgccggctacgaaggccagacggtc
gaccgcgcggccgagatcttcgagcagatgagcacccaggatgcgttcgccgagttcctg
acgctgccgctgtacgaagagatctga

DBGET integrated database retrieval system