KEGG   Methylibium petroleiphilum: Mpe_A0237Help
Entry
Mpe_A0237         CDS       T00470                                 

Definition
glutathione peroxidase transmembrane protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mpt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mpt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(253458..254075)
Genome map
AA seq 205 aa AA seqDB search
MPTLATRSASATLSPRRRPWLGRSALRRLAIAALLCIVGSGAQAACPPLLDRSFPRLQDE
KPQNLCQYAGKVVVVVNTASYCGFTSQYKGLEALHARYQSRGLVVLGFPSNDFGSQEPGS
NQDIAAFCENTFGVRFPMFAKSSVKGSARNPLYADLAQRTGKTPAWNFHKYLIGRDGQVV
LSFSSQTDPQDPVFVQEIEKLVDSQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcccactcttgccacgagatcagccagcgccaccctctcgccacggcgccgtccgtgg
ctcggtcgctcggcgttgcgacgcctcgcgatcgccgcgctactgtgcatcgtgggcagc
ggcgcacaggccgcgtgcccgccgttgctggaccgcagcttcccccgcctgcaagacgag
aagccgcagaacctctgccagtacgccggcaaggtggtggtggtggtcaacaccgccagt
tattgcggcttcacctcccagtacaaggggctcgaggcgctgcacgcccggtaccagtcg
agaggcctggtcgtgctcggcttcccgtccaatgacttcggctcgcaggaacccggcagc
aaccaggacatcgccgcattctgcgagaacaccttcggcgtcaggtttccgatgttcgcg
aagtccagcgtgaagggcagcgcccgcaacccgttgtacgcagacctcgcgcagcgcacc
gggaagacgcccgcatggaatttccacaagtacctgatcggccgcgacgggcaggtcgtg
ctcagcttctcgagtcagaccgacccgcaagaccctgtgtttgtccaagagattgaaaaa
cttgtggattcacaataa

DBGET integrated database retrieval system