KEGG   Methylibium petroleiphilum: Mpe_A0306Help
Entry
Mpe_A0306         CDS       T00470                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mpt  Methylibium petroleiphilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mpt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(332520..333551)
Genome map
AA seq 343 aa AA seqDB search
MPLHPVTPVSSYPQRFPATRARRLRRDDFTRALVREHALTASDLILPVFVLDGSNQVHDV
ASMPGVQRLSLDRLLPLAEACVRERIPVMALFPVIDAAKKTEDGREAMNPEGLVPTVVRE
LKRRFPELGVLTDVALDPFTTHGQDGLLDATGYILNDETVAVLTQQALVQAEAGVDIVAP
SDMMDGRIGAIRDALEARGLIHTRIMAYSAKYASAFYGPFRDAVGSAGNLGKSNKKVYQM
DPGNTNEALREVALDLAEGADMVMVKPGMPYLDIVRRVKEEFRVPTFAYQVSGEYAMLKA
AAANGWLDGEAVMMESLLAFKRAGADGVLSYFALDAARALNAR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgcccctccacccggtcacgcccgtgagctcctacccccaacgcttccccgccacgcgc
gcgcgccgcctgcgccgagacgacttcacccgtgcgctggtgcgcgagcacgccctcacc
gcgtcggacctgatcctgccggtgttcgtgctcgacggcagcaaccaggtgcacgacgtg
gcctcgatgcccggcgtgcagcgcctgagtctggaccggttgctgccgctggccgaggcc
tgtgtgcgcgaacgcattccggtgatggcgctgttcccggtgatcgacgcggcgaagaag
accgaggacggccgcgaagcgatgaaccccgagggcctggtgcccaccgtcgtgcgtgag
ctcaagcgccgcttcccggagctgggcgtgctgaccgatgtggcgctcgaccccttcacc
acgcacggccaggacggcctgctggacgccaccggctacatcctcaacgacgagacggtg
gccgtgctgacgcagcaggccctggtgcaagccgaggccggcgtcgacatcgtcgcgccg
agcgacatgatggatggccgcatcggcgcgatccgcgacgcgctggaggcccggggcctg
atccacacccgcatcatggcgtacagcgccaagtatgcgagcgccttctacggcccgttc
cgcgacgccgtcggctcggccggcaacttgggcaagagcaacaagaaggtctaccagatg
gatccgggcaacaccaacgaggcgctgcgcgaggtggcgttggacctcgccgaaggcgcc
gacatggtgatggtcaagcccgggatgccctatctcgacatcgtgcggcgtgtgaaggaa
gagttccgcgtgcccaccttcgcctaccaggtgagcggcgagtacgcgatgctgaaggcc
gccgccgccaacggctggctcgatggcgaggcagtgatgatggagtcgctgctggccttc
aagcgggccggtgccgacggggtgctgagctacttcgcgctcgacgccgcgcgggccctg
aacgcgcggtga

DBGET integrated database retrieval system