KEGG   Methylibium petroleiphilum: Mpe_A0457Help
Entry
Mpe_A0457         CDS       T00470                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mpt  Methylibium petroleiphilum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mpt00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mpt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
495044..496555
Genome map
AA seq 503 aa AA seqDB search
MLTALRSPAAAARWLQEWTTGTLRTDSRLVQRGDAFIAWPGHATDGRRFVKAALAAGAAT
CLVEAEGVDAHGFDDARIGALPGLKAATGAIADAYFGQPSQQLRVVATTGTNGKTSTAWW
TAQALSLLGRRCGVVGTLGIGEPPLPGRETHIDFTGLTTPDPVTLHGGLRRMADAGFEAC
AIEASSIGIVEHRLAALRIEVALFTNFTRDHLDYHGSMDAYWAAKRVLFGWPGLKAAAVN
LDDAQGAELARSLAGHVPELWTYSLERDDVRLRARDLGYVDGGLAFTLYEGGTALPVRSR
LIGDYNAANLLAVIGGLRALGVPLADAVRVVPQLTPVPGRMQKVDGDAGVAPQPEVVVDY
AHTPDALEKALGALRPLAAARGGRLLCVFGCGGNRDASKRPLMAAVAERLADRVIATSDN
PRDEAPAAILVDVAAGFAAPAAVEMIEDRRAAIARAIGSAEARDVLLIAGKGHEDYQEIA
GVKQPFSDVAEARQALAARGLAS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgcgttgcgttcgcccgccgccgcggcccgctggctccaggaatggaccacc
ggcacgctgcgcaccgacagccgcctggtgcagcgcggcgatgccttcattgcctggccc
ggccatgccaccgatggccgccgcttcgtgaaggccgcgctggccgccggtgcggcgacc
tgcctggtcgaggccgagggggtggacgcccacggcttcgacgacgcacgcatcggcgcg
ctgcccgggctcaaggccgccaccggtgcgatcgccgacgcctacttcggccagccgtcg
cagcagctgcgggtggtggccaccaccggcaccaacggcaagacctccaccgcgtggtgg
accgcgcaggcgctgagcctgctgggccggcgctgcggcgtggtcggcacgctcggcatc
ggcgagccgccgctgcccggccgcgagacgcacatcgacttcaccggcctcaccacgccc
gacccggtcacgctgcacggcgggctgcgccgcatggccgacgccggcttcgaggcctgc
gcgatcgaggcctcgtcgatcggcatcgtcgagcaccggctcgcggcactgcgcatcgaa
gtggcgctgttcaccaacttcacccgcgaccacctcgactaccacggcagcatggacgcc
tactgggccgccaagcgcgtgctgttcggctggcccgggctgaaggccgctgcggtcaac
ctcgacgatgcccagggcgccgaactggcacgcagcctggccgggcacgtgcccgaactc
tggacctattcgctcgagcgcgacgacgtgcggctgcgcgcgcgcgacctcggctatgtc
gacggcgggctcgcgttcacgctctacgagggcggcactgccctgccggtgcgcagccgc
ctgatcggcgactacaacgccgccaacctgctggccgtgatcggcggcctgcgcgcgctg
ggcgtgccgctggccgacgcggtgcgcgtggtgccgcagctcacgccggtgccgggccgc
atgcagaaggtggacggcgacgcgggcgtcgccccgcagccggaggtggtggtcgactac
gcgcacacccccgacgcgctggagaaggcgctcggtgcgctgcgtccgctggccgcggcg
cgcggcggccggttgctgtgcgtgttcggctgcggcggcaaccgcgacgccagcaagcgc
ccgctgatggccgcggtcgccgagcgactggccgaccgcgtgatcgcgaccagcgacaac
ccgcgcgacgaggcgccggcggcgatcctggtcgatgtcgccgcaggcttcgcggcgccg
gccgccgtcgagatgatcgaagaccgccgcgcggcgatcgcccgcgcgatcggcagcgcc
gaggcccgcgacgtgctgctgatcgccggcaagggccacgaggactaccaggagatcgcc
ggcgtcaagcagccgttctccgatgtggccgaggcgcggcaggcgctggcggcgcgcggg
ttggcgtcatga

DBGET integrated database retrieval system