KEGG   Methylibium petroleiphilum: Mpe_A0514Help
Entry
Mpe_A0514         CDS       T00470                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00330  Arginine and proline metabolism
mpt00332  Carbapenem biosynthesis
mpt01100  Metabolic pathways
mpt01130  Biosynthesis of antibiotics
mpt01230  Biosynthesis of amino acids
Module
mpt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mpe_A0514
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mpe_A0514
Enzymes [BR:mpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mpe_A0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABM93476
UniProt: A2SD37
Position
552323..553441
Genome map
AA seq 372 aa AA seqDB search
MSEVLRGARRIVVKVGSSLVTNEGRGVDAAAIGNWCRQLASLAGQGREVLMVSSGAIAEG
MKRLGWNARPKEIHELQAAAAVGQMGLAQMYESKLSEHGIGSAQVLLTHADLADRERYLN
ARSTLLTLLSLKVIPVINENDTVVNDEIKFGDNDTLGALVANLVDADALVILTDQPGLYS
ADPRKDPQARFIGEAVAGTPELERMAGGAGSSLGRGGMITKVLAAKRASSSGASTVIAWG
REPDVLLRLADGEAIGTLLVARTAKLAARKQWMADHLQMRGTVVIDDGAVAKLRDEGKSL
LPIGVVEVQGEFVRGDVIAVRSQVGIEIARGLANYASSEARLIARKPSSQIESLLGYSNE
PEMIHRTNLVLA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagtgctgcgtggagcgaggcgcatcgtcgtcaaggtcggatccagcctcgtg
accaacgaggggcgcggtgtcgatgccgccgcgatcggcaactggtgccgccagctcgcg
tcgctggcgggtcaggggcgcgaggtgctgatggtgtccagcggcgcgatcgccgaaggc
atgaagcgcttgggctggaacgcgcgaccgaaggagattcatgagttgcaggccgctgcc
gccgtcggacagatggggctggcgcagatgtacgagagcaagctttcggagcatggcatc
ggcagcgcgcaggtgctgttgacgcacgccgacctcgcggaccgcgagcgctacctgaac
gcacgctcgaccctgctcaccctgttgtcactgaaggtgatcccggtcatcaacgagaac
gacacggtcgtcaacgacgagatcaagttcggcgacaacgacacgctgggcgcactggtc
gccaacctcgtcgacgctgatgcgctggtgatcctgaccgatcagcctggcctgtattcc
gccgatccgcgcaaggacccgcaggcccggttcatcggtgaggctgtcgccggaacgccg
gaactcgagcggatggcaggtggtgcgggctccagcctcgggcgtggcggcatgatcacc
aaggtgctggccgccaagcgtgcctccagcagcggggcctcgaccgttatcgcctggggt
cgtgaacccgacgtgctgctgcgactcgctgacggtgaggcgatcggcacgctgctggtc
gctcgcactgccaagctcgcggcgcgcaagcagtggatggccgaccatctgcagatgcgc
ggcacggtcgtcatcgacgacggcgccgtcgccaagctgcgcgacgaaggcaagagtctg
ctgccgatcggcgtggtcgaggtgcagggcgagttcgtgcgaggtgacgtgatcgcggtg
cggagccaggtcggtatcgaaatcgcgcggggcctggccaactacgcgagcagcgaggcg
cggctgatcgcgcgcaagccgtcgtcgcagatcgagagtctgctgggctacagcaacgag
cccgagatgatccaccgcacgaatctcgtgctggcctga

DBGET integrated database retrieval system