KEGG   Methylibium petroleiphilum: Mpe_A0592Help
Entry
Mpe_A0592         CDS       T00470                                 

Definition
thiol:disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mpt  Methylibium petroleiphilum
Brite
Enzymes [BR:mpt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Mpe_A0592
Secretion system [BR:mpt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Mpe_A0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
623062..623802
Genome map
AA seq 246 aa AA seqDB search
MKFKTAALAAATVAAIATTLALTAVAQVPQEAAIRKALGERLNSSAKIDEVNKAPIAGLF
EVRIGNDVFYTDAEGAYLIRGEILDLKTKRNLTEERVAKLTAIDFASLPLKDAVVWKTGT
GARKIAVFADPNCGYCKRFEKELSNVKDLTVYTFLLPILGGDSPDKANAIWCAKDASVAW
RAWMVDGVQPPKLLGACASPVERNVELSRKHRVNGTPAIVFEDGTRVPGMLTAPQLEKQL
ASVGKS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaagacagccgcgctggcggcggcaacggtcgcagccatcgccaccaccctt
gcgttgacggccgtggcccaggtgccgcaggaggcggcgatccgcaaggcgctcggcgag
cgcctgaacagcagcgcgaagatcgacgaggtcaacaaggccccgatcgccggcctgttc
gaggtgcgcatcggcaacgacgtcttctacaccgacgccgagggcgcctacctgatccgc
ggcgagatcctcgacctgaagaccaagcgcaacctgaccgaggagcgtgtcgccaagctc
accgcgatcgacttcgcctcgttgccgctgaaggacgcggtggtctggaagaccggcacc
ggcgcacgcaagattgccgtcttcgccgacccgaactgcggctactgcaagcgcttcgag
aaggagctctcgaacgtcaaggacctgacggtctacaccttcctgctgcccatcctgggc
ggcgattcgccggacaaggcgaacgcgatctggtgcgccaaggacgcctcggtggcgtgg
cgcgcctggatggtcgacggcgtgcagccgcccaagctgctgggcgcctgtgcgtcgccg
gtggagcgcaacgtcgagctgagccgcaagcaccgggtcaacggcacgccggccatcgtg
ttcgaggacggcacccgcgtgccgggcatgctgacggcgccgcaactcgagaagcagctc
gccagcgtcggcaagtcctga

DBGET integrated database retrieval system