KEGG   Methylibium petroleiphilum: Mpe_A0597Help
Entry
Mpe_A0597         CDS       T00470                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00071  Fatty acid degradation
mpt00280  Valine, leucine and isoleucine degradation
mpt00281  Geraniol degradation
mpt00310  Lysine degradation
mpt00360  Phenylalanine metabolism
mpt00362  Benzoate degradation
mpt00380  Tryptophan metabolism
mpt00410  beta-Alanine metabolism
mpt00627  Aminobenzoate degradation
mpt00640  Propanoate metabolism
mpt00650  Butanoate metabolism
mpt00903  Limonene and pinene degradation
mpt00930  Caprolactam degradation
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01130  Biosynthesis of antibiotics
mpt01212  Fatty acid metabolism
Module
mpt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mpe_A0597
   00650 Butanoate metabolism
    Mpe_A0597
  Lipid metabolism
   00071 Fatty acid degradation
    Mpe_A0597
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mpe_A0597
   00310 Lysine degradation
    Mpe_A0597
   00360 Phenylalanine metabolism
    Mpe_A0597
   00380 Tryptophan metabolism
    Mpe_A0597
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mpe_A0597
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mpe_A0597
   00281 Geraniol degradation
    Mpe_A0597
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mpe_A0597
   00627 Aminobenzoate degradation
    Mpe_A0597
   00930 Caprolactam degradation
    Mpe_A0597
Enzymes [BR:mpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mpe_A0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABM93559
UniProt: A2SDC0
Position
627910..628698
Genome map
AA seq 262 aa AA seqDB search
MDYQHLLTEVRGSAALKTGWITLNRPKALNALNDALMDELGDALRVYDADASIGCVVITG
SEKAFAAGADIGGMASQTYMDAYKGDFITRNWEAVRSVRKPVIAAVAGYALGGGCELAMM
CDLIIAADTARFGQPEIKLGIIPGAGGTQRLPRAVGKAKAMDLVLTARMMDAAEAERAGL
VSRVVPADRLLAEAQEAADAIGAMGLPAILVAKECVNRAYESPLSDGVWFERRMFQSLFG
TEDQKEGMDAFANKRKPVFRHR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggactaccagcatctgctgaccgaagtgcgcggcagcgccgcgctgaagaccgggtgg
atcactctgaaccggcccaaggcgctgaatgcgctcaacgatgcgctgatggacgaactg
ggcgacgcgctgcgggtctacgatgccgacgcctcgatcggctgcgtggtgatcaccggc
agcgagaaggccttcgccgccggcgccgacatcggcggcatggcgtcgcagacctacatg
gacgcctacaagggcgacttcatcacccgcaactgggaggcggtgcgcagcgtgcgcaag
ccggtgatcgcggcagtggccggctacgcgctgggcggtggctgcgagctggccatgatg
tgcgacctgatcatcgccgcggacacggcgcgcttcggtcagccggagatcaagctcggc
atcatccccggcgctggcggcacgcagcggctgccgcgggcggtcggcaaggccaaggcg
atggacctggtgctgacggcacgcatgatggatgcggccgaggccgagcgcgccggcctg
gtgtcacgcgtggtgccggccgatcgcctgctggccgaggcccaggaggcggcggacgcg
atcggcgcgatggggttgccggccatcctggtggccaaggagtgcgtgaaccgcgcctac
gagtcgccgctgtcggacggcgtgtggttcgagcggcgcatgttccagtcgctgttcggc
accgaggaccagaaggaaggcatggacgccttcgcgaacaagcgcaagccggtgttccgt
caccgctga

DBGET integrated database retrieval system