KEGG   Methylibium petroleiphilum: Mpe_A0655Help
Entry
Mpe_A0655         CDS       T00470                                 

Definition
glycosyl hydrolase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mpt  Methylibium petroleiphilum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mpe_A0655
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Mpe_A0655
Enzymes [BR:mpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mpe_A0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
687489..688532
Genome map
AA seq 347 aa AA seqDB search
MNHAPIVLDIAGTALDANDRRRLRHPLVGGLILFARNWQHRAQLTSLTAEIKALRPDVLV
CVDHEGGRVQRFRSDGFTHLPPMRALGERWMQDALAATDAATACGYVLAAELRACGVDFS
FAPVLDLDHGPSGVIGDRAFHRDPRVATLLAKSLMHGLLLAGMASCGKHFPGHGYVAADS
HTEVPVDRRTLRQILGDDARPYEWLSTSLPSVMPAHVIYPKVDARPAGFSPRWLQDILRG
RLGFTGAIFSDDLSMQGATVAGTPTEAGIAALNAGCDLVLLCNQSLDGGAPLDALIDGLE
TALERGRWQASADSEARRLDLLPQAAPLPWDELMHHAPYQRALDQLP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgcccccatcgtcctcgacatcgcggggaccgcgctcgatgccaacgaccgg
cgccgcctgcgtcacccgctggtcggcgggctgatcctgttcgcccgcaactggcagcac
cgcgcccagctgacctcgctcaccgcggagatcaaggcgctgcgccccgacgtgctggtg
tgcgtcgaccatgaaggcgggcgcgtgcagcgcttccgcagcgacggcttcacccacctg
ccgccgatgcgggcgctgggcgaacgctggatgcaggatgcactggccgccaccgatgcc
gccaccgcctgcggctacgtgctggccgccgaactgcgtgcctgtggcgtcgatttcagc
ttcgcgccggtgctcgacctcgaccacgggccgagcggcgtgatcggcgaccgtgccttc
caccgcgatccgcgcgtggccacgctgctggccaagagcctgatgcacggcctgctgctg
gccggcatggcgagctgcggcaagcatttcccggggcacggctacgtggccgccgattcg
cacaccgaggtaccggtcgatcgccgcacgctgcgccagatcctcggcgacgatgcccgg
ccctacgagtggctctccacctcgctccccagcgtgatgccggcgcacgtgatctacccg
aaggtcgatgcgcggcccgccggcttctcgccgcgctggctgcaggacatcctgcgcggc
cggctcggcttcaccggcgcgatcttcagcgacgacctcagtatgcagggcgcgaccgtc
gccggcacgcctaccgaggccggcatcgccgcgctgaacgccggctgcgacctggtgctg
ctgtgcaaccagtctctcgacggcggcgcaccgctcgatgcgctgatcgacgggttggag
acggcgctcgagcgtggccgctggcaggccagcgccgacagcgaggcgcgccgcctcgac
ctgctgccgcaggcggcgccgttgccctgggacgagctgatgcaccacgcgccctaccag
cgcgcgctcgaccaactgccctga

DBGET integrated database retrieval system