KEGG   Methylibium petroleiphilum: Mpe_A0713Help
Entry
Mpe_A0713         CDS       T00470                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpe_A0713
   01230 Biosynthesis of amino acids
    Mpe_A0713
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpe_A0713
  Energy metabolism
   00680 Methane metabolism
    Mpe_A0713
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpe_A0713
Enzymes [BR:mpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mpe_A0713
Exosome [BR:mpt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mpe_A0713
  Exosomal proteins of melanoma cells
   Mpe_A0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(741241..741984)
Genome map
AA seq 247 aa AA seqDB search
MTQLVLIRHGESTWNLENRFTGWTDVELTPTGVAQAQQAGRLLKQAGIDFDTVYTSVLKR
AIWTAWHCLDGMDRTWLPVIKDWRLNERHYGGLQGLNKADMAKQFGDEQVLLWRRSYDVP
PPPLEANDPRSERSDVRYAKLAANQVPLTECLKDTVARVLPLWYGTLAPAIAAGQRLVIV
AHGNSIRALVKHLNNISDADIVGVNIPNGIPLVYDLDANLKPTSKYYLGGADAAAQAASV
SALQADG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacccaactcgtgctgatccgccacggcgaatcgacctggaacctcgagaaccgcttc
accggctggaccgatgtggaactcactcccaccggcgtggcccaggcccagcaggccggc
cggctgctgaagcaggccggcatcgatttcgacaccgtctacacctcggtgctcaagcgc
gcgatctggaccgcctggcactgcctcgacggcatggaccgcacctggctgccggtcatc
aaggactggcgcctcaacgagcgccactacggcggcctgcagggcctgaacaaggccgac
atggccaagcagttcggcgacgagcaggtgctgctctggcgccgcagctacgacgtgccg
ccgccgccgctggaagcgaacgacccgcgcagcgagcgcagcgacgtgcgctacgcgaag
ctcgcggccaaccaggtgccgctgaccgagtgcctgaaggacaccgtggcgcgcgtgctg
ccgctctggtacggcacgctggccccggccatcgccgccggccagcggctggtgatcgtg
gcgcacggcaacagcatccgcgcgctggtgaagcacctgaacaacatctccgacgccgac
atcgtgggcgtgaacatcccgaacggcatcccgctggtctacgacctggacgccaacctg
aagcccacgtcgaagtactacctgggcggggccgacgccgccgcgcaggcggcctcggtg
tccgcgctgcaggcggacggctga

DBGET integrated database retrieval system