KEGG   Methylibium petroleiphilum: Mpe_A0837Help
Entry
Mpe_A0837         CDS       T00470                                 

Definition
phosphoribosyl-AMP cyclohydrolase (EC:3.5.4.19)
Orthology
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
mpt  Methylibium petroleiphilum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpe_A0837
  Amino acid metabolism
   00340 Histidine metabolism
    Mpe_A0837
Enzymes [BR:mpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Mpe_A0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
876513..876902
Genome map
AA seq 129 aa AA seqDB search
MTWLDDIRWDRDGLLPVIAQEAATGDVLMFAWMNREALARTAELGEAVYWSRSRGRLWHK
GEESGHIQKVRDMRLDCDNDVLLLKVEQLGHEPSIACHTGRHSCFYQRYESGAWHAVELV
LKDPEHIYR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacttggctcgatgacattcgctgggaccgcgacggcctgctgccggtgatcgcgcag
gaagccgccaccggcgacgtgctgatgttcgcgtggatgaaccgcgaggcgctggcgcgc
acggccgaactgggcgaggcggtgtactggagccgctcgcgcggcaggctgtggcacaag
ggcgaggagtcgggccacatccagaaggtgcgcgacatgcggctggactgcgacaacgac
gtgctgctgctgaaggtcgaacagctcggccatgagccctcgatcgcctgccacaccggt
cgccacagctgcttctatcaacggtatgagagcggcgcctggcacgcggtcgagctggtg
ctgaaggacccggagcacatctacagatga

DBGET integrated database retrieval system