KEGG   Methylibium petroleiphilum: Mpe_A1019Help
Entry
Mpe_A1019         CDS       T00470                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mpt  Methylibium petroleiphilum
Brite
Enzymes [BR:mpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mpe_A1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1085404..1086459
Genome map
AA seq 351 aa AA seqDB search
MISGNYPDSVERSSELLRLALPQMAKHSVALHPINYAVWYEYVSGRSSDLKAEIERLTAD
GRALTEADVARLFKAYVAPVGLETSERVAENARRILRSMEQDALEATDRTSAFDQSLSQW
QAELDREANGGAVLQGVVDSTREMSEAMRQLQSRLDVNQREIAQLRAEVAAARSEAQTDS
LTGLHNRRSFEQHIAKFLADREAAMSLVLVDIDHFKLVNDTHGHLFGDQVLMAVARVLKE
SVRNDDLAARIGGEEFALLLPSTPLKGAVELAERIRTSIANSRIRRRNSEQQVGQITVSL
GVADLWPSDNGESWFSRADEALYASKREGRNRVTAPSLLSRHAVTGGVNRS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcaggcaactaccccgacagtgtcgagcggagcagcgaacttctgaggctcgcg
ctcccgcagatggccaagcattcggtcgccctgcaccccatcaactacgcggtctggtac
gagtatgtgtcgggccgcagcagcgacctgaaggccgagatcgagcggctcaccgccgac
gggcgggccctgaccgaggccgacgtggcccggctgttcaaggcctatgtcgcgccggtc
gggctcgagacctccgagcgggtggccgagaacgcccgccgcatcctgcgcagcatggag
caggatgcgctggaggcgaccgaccgcacctcggccttcgaccagtcgctgtcgcagtgg
caggccgagctcgatcgcgaggcgaacggtggcgcggtgctgcagggcgtggtggacagc
acgcgcgagatgtcggaagcgatgcgccagctgcagagccggctggacgtgaaccagcgc
gagatcgcgcagctacgggccgaggtggctgccgcccgcagcgaggcacagaccgacagc
ctgaccggcctgcacaaccgccgctccttcgagcagcacatcgccaagttcctggccgac
cgcgaggcggcgatgtcgctggtgctggtcgacatcgaccacttcaagctggtcaacgac
acccacggccatctgttcggtgaccaggtgctgatggcggtggcgcgggtgctgaaggag
agcgtgcgcaacgacgacctggccgcccgcatcggcggcgaggagttcgcactgctgctg
ccgtcgacgccgctcaagggcgcggtcgagctggccgagcgcatccgcacctcgatcgcc
aacagccgcatccgccgccgcaacagcgagcagcaggtcgggcagatcacggtgtcgctc
ggcgtcgccgacctgtggcccagcgacaacggcgagagctggttctcgcgtgccgacgag
gcgctctacgcctccaagcgcgagggtcgcaatcgcgtcacggcgccgtcgctgctgtca
cggcatgccgtgaccggcggcgtcaaccggtcctag

DBGET integrated database retrieval system