KEGG   Methylibium petroleiphilum: Mpe_A1074Help
Entry
Mpe_A1074         CDS       T00470                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mpt  Methylibium petroleiphilum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mpe_A1074
Enzymes [BR:mpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mpe_A1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1146900..1147631
Genome map
AA seq 243 aa AA seqDB search
MNAPHTLPSLRAVPDDEGVPVSVKIRERIKSQRERFHANDNIAEFIEPGELEQLLDEVAG
KMRGVLDSLVIDTESDHNTQDTARRVAKMYLNEVFKGRYVHEPAVTEFPNVEHLNELMII
GPITVRSACSHHFCPIMGRVWIGVMPNEHSNLIGLSKYARLTEWIMSRPQIQEEAVTQVA
DLLQDKMSPDGLAIVMEADHFCMQWRGVRDLDSKMINSVMRGVFLKDANLRREFLSLVNN
KKG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctccccacaccctgcccagcctccgtgccgtgcccgacgacgaaggcgtgccg
gtttccgtcaagatccgcgagcgaatcaagtcgcagcgcgagcgtttccacgccaacgac
aacatcgccgagttcatcgagccgggcgagctggagcagttgctcgacgaagtggccggc
aagatgcgcggcgtgctcgacagcctggtgatcgacaccgagagcgaccacaacacccag
gacaccgcgcgccgcgtcgccaagatgtacctgaacgaggtcttcaagggccgctacgtg
cacgagccggcggtcaccgagttcccgaacgtcgagcacctgaacgagctgatgatcatc
ggcccgatcaccgtgcggagcgcctgctcgcaccatttctgcccgatcatgggtcgggtg
tggatcggtgtgatgcccaacgagcactccaacctgatcggtctttccaagtacgcgcgt
cttaccgagtggatcatgagccggccgcagatccaggaggaggccgtgacccaggtggcc
gatctgctgcaggacaagatgagccccgacggcctggcgatcgtgatggaggccgaccac
ttctgcatgcaatggcgcggcgtgcgtgacctggactccaagatgatcaacagcgtgatg
cgtggcgtgttcctgaaggacgccaacctgcgacgcgagttcctctcgctggtcaacaac
aagaagggctga

DBGET integrated database retrieval system