KEGG   Methylibium petroleiphilum: Mpe_A1081Help
Entry
Mpe_A1081         CDS       T00470                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00220  Arginine biosynthesis
mpt00330  Arginine and proline metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01130  Biosynthesis of antibiotics
mpt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Mpe_A1081
   00330 Arginine and proline metabolism
    Mpe_A1081
Enzymes [BR:mpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mpe_A1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABM94042
UniProt: A2SEQ3
Position
complement(1154337..1155272)
Genome map
AA seq 311 aa AA seqDB search
MSADLRRLAPLISLIGAPTDIGAGARGASMGPEALRVANLQSTLEAHGLEVVDRGNLAGP
RNPWLPPTEGYRHLAEVVAWNTAVHEAVHAELGLGRLPILLGGDHCLAIGSISAVARHCR
EAGKKLRVLWLDAHADFNTNVLTPTGNVHGMPVACLCGRGPQALIEIGGQVPAINPKWVR
QIGIRSVDAGERRLVHEVDLEVFDMRYIDEMGMRHTMELALATLDANTHLHVSFDVDFLD
PPIAPGVGTTVNGGPTYREAQLCMEMIADTGRLASLDVMELNPAFDVRNATAVLAVDLVE
SLFGKSTLMRK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacctccgccgcctcgcgccgctgatctctctgatcggtgcgcccaccgac
atcggcgccggcgcgcgcggtgcgtcgatgggtccggaagcgctgcgcgtggccaacctg
cagagcacgctggaggcgcacggcctggaggtggtcgaccgcggcaaccttgcaggaccc
cgcaacccctggctgccgccgaccgagggctaccgccacctcgccgaggtggtggcatgg
aataccgcggtgcacgaagcggtgcatgccgagctcggcctggggcggttgcccatcctg
ctgggcggcgaccactgcctcgcgatcggcagcatcagcgcggtggcgcgccactgccgc
gaggcgggcaagaagctgcgcgtgctgtggctcgatgcgcacgccgacttcaacaccaac
gtgctcacgcccaccggcaacgtgcatggcatgccggtcgcgtgcctgtgcggccgcggc
ccgcaggcgctgatcgagatcggtggccaggtgccggcgatcaatccgaagtgggtgcgc
cagatcggcatccgcagcgtcgacgccggcgagcggcggctggtgcacgaggtcgacctc
gaggtgttcgacatgcgctacatcgacgagatgggcatgcgccacacgatggagctcgcg
ctcgcgacgctggacgccaacactcacctgcacgtgagcttcgacgtcgacttcctcgat
ccgcccatcgcgcccggcgtcggcaccaccgtcaatggcggcccgacctaccgcgaggcg
cagctgtgcatggaaatgatcgccgacaccggccgcctcgcctcgctcgacgtgatggaa
ctgaacccggccttcgacgtgcgcaatgcgacagcggtgcttgcggtggacctggtggag
tcgctgttcggcaagagcacgttgatgcgaaagtag

DBGET integrated database retrieval system