KEGG   Methylibium petroleiphilum: Mpe_A1081Help
Entry
Mpe_A1081         CDS       T00470                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mpt  Methylibium petroleiphilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpt01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mpt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1154337..1155272)
Genome map
AA seq 311 aa AA seqDB search
MSADLRRLAPLISLIGAPTDIGAGARGASMGPEALRVANLQSTLEAHGLEVVDRGNLAGP
RNPWLPPTEGYRHLAEVVAWNTAVHEAVHAELGLGRLPILLGGDHCLAIGSISAVARHCR
EAGKKLRVLWLDAHADFNTNVLTPTGNVHGMPVACLCGRGPQALIEIGGQVPAINPKWVR
QIGIRSVDAGERRLVHEVDLEVFDMRYIDEMGMRHTMELALATLDANTHLHVSFDVDFLD
PPIAPGVGTTVNGGPTYREAQLCMEMIADTGRLASLDVMELNPAFDVRNATAVLAVDLVE
SLFGKSTLMRK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacctccgccgcctcgcgccgctgatctctctgatcggtgcgcccaccgac
atcggcgccggcgcgcgcggtgcgtcgatgggtccggaagcgctgcgcgtggccaacctg
cagagcacgctggaggcgcacggcctggaggtggtcgaccgcggcaaccttgcaggaccc
cgcaacccctggctgccgccgaccgagggctaccgccacctcgccgaggtggtggcatgg
aataccgcggtgcacgaagcggtgcatgccgagctcggcctggggcggttgcccatcctg
ctgggcggcgaccactgcctcgcgatcggcagcatcagcgcggtggcgcgccactgccgc
gaggcgggcaagaagctgcgcgtgctgtggctcgatgcgcacgccgacttcaacaccaac
gtgctcacgcccaccggcaacgtgcatggcatgccggtcgcgtgcctgtgcggccgcggc
ccgcaggcgctgatcgagatcggtggccaggtgccggcgatcaatccgaagtgggtgcgc
cagatcggcatccgcagcgtcgacgccggcgagcggcggctggtgcacgaggtcgacctc
gaggtgttcgacatgcgctacatcgacgagatgggcatgcgccacacgatggagctcgcg
ctcgcgacgctggacgccaacactcacctgcacgtgagcttcgacgtcgacttcctcgat
ccgcccatcgcgcccggcgtcggcaccaccgtcaatggcggcccgacctaccgcgaggcg
cagctgtgcatggaaatgatcgccgacaccggccgcctcgcctcgctcgacgtgatggaa
ctgaacccggccttcgacgtgcgcaatgcgacagcggtgcttgcggtggacctggtggag
tcgctgttcggcaagagcacgttgatgcgaaagtag

DBGET integrated database retrieval system