KEGG   Methylibium petroleiphilum: Mpe_A1542Help
Entry
Mpe_A1542         CDS       T00470                                 

Definition
(GenBank) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpe_A1542
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpe_A1542
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mpe_A1542
Enzymes [BR:mpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mpe_A1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1663021..1664433
Genome map
AA seq 470 aa AA seqDB search
MNYLSTRGDSTPRGFSDILLEGLAPDGGLYLPERYPRVDAATLARWRGLSYADLAFEILS
LYITDIPADDLRTLIRKTYTREVFGTTEITPLKPLEPGVALQALSNGPTLAFKDMAMQLL
GQLFEYELARRGETLNILGATSGDTGSAAEYAMRGKQGVRVFMLSPHGRMSPFQQAQMFS
LPDANIHNLAVEGVFDDCQDIVKAVSNDLEFKRRWRIGTVNSINWARLLAQVVYYFAGYF
QATKSNDERVSFSVPSGNFGNVCAGHVARMMGLPIEQLVVATNENDVLDEFFRTGSYRVR
GAADTHETSSPSMDISKASNFERFVFDLLGRDAARTRQLFGDDIARHGGFTLTPAEFARV
REFGFVSGKSTHADRVATIRDTQQRFGVTIDPHTADGLKVGRAYVKPGTPLLVLETALPI
KFAATILEALGHEPPRPAGLEGLEQLPRRFKVMPASSATVQAYIVENCST
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctcagcacccgcggcgactccacgccgcgcggcttctccgacatcctgctc
gaaggcctggcgccggatgggggtctctacctgccggagcgctatccgcgcgtcgatgcg
gccacgctggcgcgctggcgcggcctgtcctacgccgacctcgcgttcgagatcctgtcg
ctctacatcaccgacattccggccgacgacctgcgcacgctgatccgcaagacctacacg
cgcgaggtcttcggtacgaccgagatcaccccgctgaagccgctggagcctggcgtcgcg
ctgcaggccctgtcgaacggaccgacgctcgcgttcaaggacatggccatgcagctgctg
ggccagctgttcgagtacgagctggcgcgccgcggcgaaacgctcaacatcctgggcgcg
acctccggcgacaccggcagcgcggccgagtacgcgatgcgcggcaagcagggcgtgcgc
gtcttcatgctcagtccgcacggccgcatgagcccgttccagcaagcgcagatgttcagc
ttgcccgacgcgaacattcacaacctcgcggtcgagggcgtgttcgacgactgccaggac
atcgtcaaggccgtgtccaacgacctggagttcaagcgccgctggcgcatcggcaccgtc
aactccatcaactgggcaaggctgctggcgcaggtggtgtattacttcgccggttatttc
caggccacgaagtcgaacgacgagcgggtgagcttctcggtgccatcgggcaacttcggc
aacgtgtgcgccggccatgtggcgcgcatgatgggcctgccgatcgagcagctggtggtc
gcgacaaacgagaacgacgtgctcgacgagttcttccgcaccggcagctaccgcgtgcgc
ggcgcggccgacacgcatgagacttcgagtccctcgatggacatctccaaggccagcaac
ttcgagcgcttcgtgttcgacctgctgggtcgcgacgcggcacgcacgcgccagctgttc
ggtgacgacatcgcacggcacggcggcttcacgctgacgcccgccgagtttgcgcgggtg
cgcgagttcggcttcgtgtccggcaagagcacgcacgccgaccgcgtggcgaccatccgc
gacactcagcagcgtttcggcgtgaccatcgacccgcacaccgccgacggcctgaaggtg
ggccgtgcgtacgtgaagcccggcacgccgctgctggtgctggagaccgcgctgccgatc
aagttcgccgccaccatcctcgaggcgctcggccacgagccgccccggccggccgggctc
gaggggctcgagcagctccccaggcgcttcaaggtcatgccggccagctcggcgacggtg
caggcctacatcgtcgagaattgttcgacatga

DBGET integrated database retrieval system