KEGG   Methylibium petroleiphilum: Mpe_A1576Help
Entry
Mpe_A1576         CDS       T00470                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (BDH) oxidoreductase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mpt  Methylibium petroleiphilum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mpe_A1576
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mpe_A1576
Enzymes [BR:mpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mpe_A1576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1701503..1702285)
Genome map
AA seq 260 aa AA seqDB search
MLNSKTALVTGSTSGIGLGIAIVLARQGANIILNGFGDSEAPKAEVLAAGKAHGIKVGYH
GADMSKAAEIEALMAYAAADFGGVDILVNNAGIQHVANVEDFPVAKWDAIIAINLSSAFH
TTRLAIPQMRRKNWGRVLNIASAHGLVASAGKSAYVAAKHGLVGFTKSIALETATTGITV
NAICPGWVLTPLVQKQIDDRSAREGIPVLQAEKELLGEKQPSLQFTTPEQLGELAVFLCS
DAASNVKGQAWAMDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacagcaagaccgcactcgtcaccggctcgaccagcggtatcggcctcggcatc
gcgatcgtcctggcgcgccagggcgcgaacatcatcctcaacggctttggcgacagcgag
gcaccgaaggcggaggtgctggcggccggcaaggcccacggcatcaaggtgggctaccac
ggcgccgacatgagcaaggcagccgagatcgaggccctgatggcctacgcggcggccgat
ttcggcggcgtcgacatcctggtcaacaacgccggcatccagcacgtggccaacgtcgag
gacttccccgtcgccaagtgggacgcgatcatcgcgatcaacctgagctcggccttccac
accacgcgcctggcgatcccgcagatgcgcaggaagaactggggccgcgtgctcaacatc
gcctcagcccacggcctggtggcctcggccggcaagagcgcctacgtggccgccaagcac
gggctggtgggcttcaccaagtcgatcgcgctcgagaccgcgaccaccggcatcaccgtc
aacgcgatctgcccgggctgggtgttgacgccgctggtgcagaagcagatcgacgaccgc
tcggcccgcgagggcatcccggtcttgcaggccgagaaggagctgctgggcgagaagcag
ccttcgctgcagttcaccacgcccgagcagttgggcgagctggccgtcttcctgtgttcg
gacgccgcgtccaacgtgaagggccaggcgtgggcgatggacggtgggtggacggcgcag
tag

DBGET integrated database retrieval system