KEGG   Methylibium petroleiphilum: Mpe_A1890Help
Entry
Mpe_A1890         CDS       T00470                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mpt  Methylibium petroleiphilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mpt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2025238..2026185
Genome map
AA seq 315 aa AA seqDB search
MMAAMTSFAFLSGSSFLKLPSQADRPYAIAGLAWDGAVTNRPGARFGPRAIREASHMLCD
GIHPHFNIDPAPYLTDLGDLPLPNTSLEAMRVAMAPSVNAMIRAHHMAWIGGDHSVTLPL
LRAYKSWLGRPLAVIHFDAHCDTWEDHFGEPSGHGTWVYEALQEGLVLPECFTQIGIRSA
GAREARDYVRTRGGQIFDARQLRGLESPAQLAPVTTAIRKRLAAHGNPPLYLSLDIDCLD
PAFAPGTGTPEPGGMTTNQVLSLLEELADLDFVGMDCVEVAPPYDHAELTSYAAASFVWT
YLCGQLARRGATRPA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccatgacttccttcgccttcctctccggcagcagcttcctgaagcttcca
tcacaagccgatcggccctatgccatcgccggcctcgcgtgggatggcgcggtcaccaac
cgaccgggcgctcgcttcggtccgcgcgccatccgcgaagcaagccacatgctgtgcgac
ggcatccatccgcacttcaacatcgaccccgcgccctacctgaccgacctcggtgacctg
ccgctgcccaacaccagcctcgaagccatgcgcgtggccatggcgccgagcgtgaacgcg
atgatccgcgcccaccacatggcctggatcggcggcgatcactcggtcacgctgccactt
ctgcgggcctacaagtcctggctcggccgaccgctggcggtgatccatttcgatgcccac
tgcgacacctgggaagaccacttcggcgagcccagcggccatggaacgtgggtctacgag
gccctccaggagggcctggtgctgcccgaatgcttcacccagatcggcatccgctcggcg
ggcgcacgcgaggcacgcgactatgtgcggacccggggcggacagatcttcgacgcgcgg
caactgcgtggcctcgagagcccggcgcagctggcgcccgtgaccaccgcgattcggaag
cggctcgccgcccacggcaacccgccgctctacctcagcctcgacatcgattgcctcgac
ccggcgttcgcaccaggcaccggcacacccgaacccggcggcatgacgacgaaccaggtg
ctgtcgctgctggaggaactggctgatctcgatttcgtcggcatggattgcgtggaggtc
gctccaccctacgaccacgccgaactcacgagctacgctgcggcaagtttcgtgtggacc
tacctgtgcggtcagctggcgcgccgcggcgccacacggccggcctga

DBGET integrated database retrieval system