KEGG   Methylibium petroleiphilum: Mpe_A2012Help
Entry
Mpe_A2012         CDS       T00470                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mpt  Methylibium petroleiphilum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpe_A2012
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpe_A2012
  Amino acid metabolism
   00310 Lysine degradation
    Mpe_A2012
Enzymes [BR:mpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mpe_A2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2154721..2156001)
Genome map
AA seq 426 aa AA seqDB search
MAIIEVKVPQLSESVAEATLLQWKKKPGEAVAIDEILIEIETDKVVLEVPAPAAGVLAQL
VKNDGESCVSDEVIAKIDTEGKEAVSPLEVKPVPEVKPAPGAASDTAGAKGDVAMPAAAK
LLAENQLGAGQVAGSGKDGRVTKGDVQAALQTGAKAAAPAVAAPAAAAVSVPVAPSVAKA
LPAVTVPAALNLGDRPEQRVPMSRLRARVAERLLQSQATNAILTTFNEVNMAPVMEMRKR
FQEKFEKEHGVKIGFMSFFVKAAVAALKRYPVINASVDGNDIVYHGYFDIGIAVGSPRGL
VVPILRNADQMSFADIEKKIAEFGQKARDGKLSLEDLTGGTFSISNGGTFGSMLSTPIIN
PPQSAILGVHATKDRAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPA
RLLFDI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggccatcattgaagtcaaagtcccccagctgagcgagtccgttgccgaagcgacgctg
ctgcagtggaagaagaagcccggcgaagccgtggcgatcgatgagatcctgatcgagatc
gagaccgacaaggtcgtgctcgaggtgccggcaccggctgccggcgtgctggcgcaactg
gtcaagaacgacggcgagagctgcgtcagcgacgaggtgatcgcgaagatcgataccgag
ggcaaggaagcggtcagcccgctcgaggtcaagccggtgcccgaggtcaagccggcgccc
ggcgccgcgtccgatacggccggcgcgaagggcgacgtggcgatgcccgcggccgcgaag
ctgctggccgagaaccagctgggtgcgggccaggtggccggtagcggcaaggatggtcgc
gtgaccaagggcgacgtgcaggcagcgctgcagaccggcgccaaggcagcggcgcccgcc
gtcgctgccccggcagcggctgccgtctcggtgccggtcgcgccatccgtcgccaaggcg
ctgcccgccgtcacggtgccggccgcgctgaacttgggcgaccgccccgagcagcgcgtg
ccgatgtcgcgcctgcgggcccgcgtggccgagcggctgctgcagtcgcaggcgaccaac
gccatcctgaccaccttcaacgaggtcaacatggccccggtgatggagatgcgcaagcgt
ttccaggagaagttcgagaaggaacacggcgtcaagatcggcttcatgagcttcttcgtg
aaggcggcggtcgcggcgctcaagcgctacccggtcatcaacgccagcgtggacggcaac
gacatcgtctaccacggctacttcgacatcggcatcgcggtgggctcgccgcgcggcctg
gtggtgccgatcctgcgcaacgccgaccagatgagcttcgccgacatcgagaagaagatc
gccgaattcggccagaaggcccgcgacggcaagctgtcgctcgaggacctgaccggcggc
accttctccatctccaacggtggcaccttcggttcgatgctgagcacgccgatcatcaac
ccgccgcagagcgccatcctgggcgtgcacgcgacgaaggaccgcgcggtggtcgagaac
ggccagatcgtgatccggccgatgaactacctggcgatgtcctacgaccaccgcatcatc
gacggccgcgaggcggttctgggcctcgtggcgatgaaggaagcgctggaagacccggcg
cgcctgctgttcgatatctga

DBGET integrated database retrieval system