KEGG   Methylibium petroleiphilum: Mpe_A2156Help
Entry
Mpe_A2156         CDS       T00470                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpe_A2156
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpe_A2156
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpe_A2156
Enzymes [BR:mpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpe_A2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2312100..2312918)
Genome map
AA seq 272 aa AA seqDB search
MSRIAATFERLRGQRRTALIPYITAGDPYADATVDIMLAMAGAGADVIELGVPFSDPMAD
GPVIQKASERALAKGIGMGQVLAMVRSFREHNDTTPVVLMGYANPVERYGIDRFVADAKS
AGVDGVLVVDYPPEECEAFAAQLQGADLDPIFLLAPTSTEQRMKDVGRIARGYVYYVSLK
GVTGAGHLDTDAVATMLPRIREHVKVPVGVGFGIRDAATAKALAAVADAVVIGSRIVQLL
EAEPRESVAAVGGTFIASIREALDSSTEGVRA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcatcgctgcgaccttcgagcggctgcgcgggcagcggcgcaccgcgctgatt
ccctacatcaccgccggcgatccctacgccgacgccaccgtcgacatcatgctggcgatg
gccggagccggggccgacgtcatcgaactcggcgtgccgttctccgacccgatggccgac
ggccctgtgatccagaaggcctcggagcgggcgttggccaaaggcatcggcatgggtcag
gtgctggcgatggtgcggagcttccgagagcacaacgacaccacgccggtggtcctgatg
ggctacgcgaacccggtcgagcgctatggcatcgaccgcttcgtcgccgacgccaagtcg
gccggtgtcgacggtgtgctggtggtcgactacccgcctgaggagtgcgaggctttcgcc
gcgcaactgcagggcgcggacctcgacccgatcttcctgctcgccccgacctccaccgag
cagcgtatgaaggacgtgggccgcattgcgcggggctacgtctactacgtgtcgctcaag
ggcgtgaccggagcagggcacctggacaccgacgccgtcgcgacgatgctgccgcgcatc
cgcgagcacgtgaaagtgccggtcggcgtgggtttcggcattcgcgacgcggccactgcg
aaggcgcttgcagcggtggccgacgcggtcgtcatcggctcgcgcatcgtccagttgctg
gaagccgagccgcgcgagagcgtcgctgccgtcggcggcaccttcattgcctcgatccgc
gaggcgctagattcttcaaccgaaggagtgcgtgcatga

DBGET integrated database retrieval system