KEGG   Methylibium petroleiphilum: Mpe_A2157Help
Entry
Mpe_A2157         CDS       T00470                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00260  Glycine, serine and threonine metabolism
mpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01130  Biosynthesis of antibiotics
mpt01230  Biosynthesis of amino acids
Module
mpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpe_A2157
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpe_A2157
Enzymes [BR:mpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpe_A2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABM95113
UniProt: A2SHS4
Position
complement(2312915..2314153)
Genome map
AA seq 412 aa AA seqDB search
MLNYQQPDASGHFGRYGGSFVAETLIHALDELKAAYARYRDDPEFVAEFKSELAHFVGRP
SPIYHAARMSRELGGAQIYLKREDLNHTGAHKINNTIGQALLARRMGKPRVIAETGAGQH
GVATATICARYGMECVVYMGSEDVKRQSPNVYRMHLLGARVVPVDSGSKTLKDALNEALR
DWVTNVENTFYIIGTVAGPAPYPEMVRDFQSVIGEECLRQMPEMAGRQPDAVIACVGGGS
NAMGIFYPYIRHEGVRLIGVEAAGHGLDSGKHAASLSAGSPGVLHGNRTYLLQDANGQII
ETHSISAGLDYPGVGPEHAYLKDIGRAEYVGITDDEALQAFHRLCRTEGIIPALESSHAV
AYAMKLAPTMRSDQSLLVNLSGRGDKDIGTVADLSGAEFYDRPSSRGEKVKQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattaccagcaacccgatgcgagcggccatttcggccgctatggcggcagcttc
gtcgccgagaccctgatccacgcgctcgacgaactgaaggccgcctacgcgcgctatcgc
gacgatcccgagttcgtggccgagttcaagagcgagctcgcgcatttcgtcggccgaccc
agtccgatctaccacgccgcgcgcatgagccgcgagctcggtggcgcccagatctacctg
aagcgcgaggacctcaaccacaccggcgcccacaagatcaacaacaccatcggccaggcg
ctgctggcccggcgcatgggcaagccgcgcgtgatcgccgaaaccggtgccggccagcac
ggcgtggccaccgccaccatctgtgcccgctacggcatggaatgcgtggtctacatgggc
agcgaggacgtgaagcgccagtcgcccaacgtctaccgcatgcacctgctgggcgccagg
gtggtgccggtggacagcggcagcaagacgctgaaggacgcgctgaacgaggcgctgcgc
gactgggtcaccaacgtcgagaacaccttctacatcatcggcaccgtggccggcccggcg
ccgtacccggagatggtgcgtgacttccagagcgtcatcggcgaggaatgcctgcggcag
atgccggagatggcgggtcgccagcccgacgcggtgatcgcctgcgtcggcggcggcagc
aatgcgatgggcatcttctacccgtatatccgacacgagggcgtgcgcctgatcggcgtg
gaggcggccggacacgggctcgactccggcaagcatgcggccagcctcagcgccggctcg
ccgggcgtgctgcacggcaaccgcacctacctgttgcaggacgcgaacggccagatcatc
gagacgcactcgatctccgccggactcgattaccccggcgtcggccctgagcacgcctac
ctgaaggacatcgggcgggccgagtacgtcggcatcaccgacgacgaggcgctgcaggcc
tttcaccggctgtgccgcaccgaaggcatcatcccggcgcttgaatccagccatgcggtg
gcctacgcgatgaaactggcgccgacgatgcgcagcgaccagagtctgctggtcaatctg
tccggccggggcgacaaggacatcggcaccgttgccgacctgtccggcgccgagttctac
gaccggccgtcgtcgcgcggcgagaaggtgaagcaatga

DBGET integrated database retrieval system