KEGG   Methylibium petroleiphilum: Mpe_A2157Help
Entry
Mpe_A2157         CDS       T00470                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpe_A2157
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpe_A2157
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpe_A2157
Enzymes [BR:mpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpe_A2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2312915..2314153)
Genome map
AA seq 412 aa AA seqDB search
MLNYQQPDASGHFGRYGGSFVAETLIHALDELKAAYARYRDDPEFVAEFKSELAHFVGRP
SPIYHAARMSRELGGAQIYLKREDLNHTGAHKINNTIGQALLARRMGKPRVIAETGAGQH
GVATATICARYGMECVVYMGSEDVKRQSPNVYRMHLLGARVVPVDSGSKTLKDALNEALR
DWVTNVENTFYIIGTVAGPAPYPEMVRDFQSVIGEECLRQMPEMAGRQPDAVIACVGGGS
NAMGIFYPYIRHEGVRLIGVEAAGHGLDSGKHAASLSAGSPGVLHGNRTYLLQDANGQII
ETHSISAGLDYPGVGPEHAYLKDIGRAEYVGITDDEALQAFHRLCRTEGIIPALESSHAV
AYAMKLAPTMRSDQSLLVNLSGRGDKDIGTVADLSGAEFYDRPSSRGEKVKQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattaccagcaacccgatgcgagcggccatttcggccgctatggcggcagcttc
gtcgccgagaccctgatccacgcgctcgacgaactgaaggccgcctacgcgcgctatcgc
gacgatcccgagttcgtggccgagttcaagagcgagctcgcgcatttcgtcggccgaccc
agtccgatctaccacgccgcgcgcatgagccgcgagctcggtggcgcccagatctacctg
aagcgcgaggacctcaaccacaccggcgcccacaagatcaacaacaccatcggccaggcg
ctgctggcccggcgcatgggcaagccgcgcgtgatcgccgaaaccggtgccggccagcac
ggcgtggccaccgccaccatctgtgcccgctacggcatggaatgcgtggtctacatgggc
agcgaggacgtgaagcgccagtcgcccaacgtctaccgcatgcacctgctgggcgccagg
gtggtgccggtggacagcggcagcaagacgctgaaggacgcgctgaacgaggcgctgcgc
gactgggtcaccaacgtcgagaacaccttctacatcatcggcaccgtggccggcccggcg
ccgtacccggagatggtgcgtgacttccagagcgtcatcggcgaggaatgcctgcggcag
atgccggagatggcgggtcgccagcccgacgcggtgatcgcctgcgtcggcggcggcagc
aatgcgatgggcatcttctacccgtatatccgacacgagggcgtgcgcctgatcggcgtg
gaggcggccggacacgggctcgactccggcaagcatgcggccagcctcagcgccggctcg
ccgggcgtgctgcacggcaaccgcacctacctgttgcaggacgcgaacggccagatcatc
gagacgcactcgatctccgccggactcgattaccccggcgtcggccctgagcacgcctac
ctgaaggacatcgggcgggccgagtacgtcggcatcaccgacgacgaggcgctgcaggcc
tttcaccggctgtgccgcaccgaaggcatcatcccggcgcttgaatccagccatgcggtg
gcctacgcgatgaaactggcgccgacgatgcgcagcgaccagagtctgctggtcaatctg
tccggccggggcgacaaggacatcggcaccgttgccgacctgtccggcgccgagttctac
gaccggccgtcgtcgcgcggcgagaaggtgaagcaatga

DBGET integrated database retrieval system