KEGG   Methylibium petroleiphilum: Mpe_A2169Help
Entry
Mpe_A2169         CDS       T00470                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mpt  Methylibium petroleiphilum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpe_A2169
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpe_A2169
   00650 Butanoate metabolism
    Mpe_A2169
  Energy metabolism
   00190 Oxidative phosphorylation
    Mpe_A2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2327261..2327623)
Genome map
AA seq 120 aa AA seqDB search
MTQNYGSKRIVVGAHYGLRDWLSQRVTAALMAIFTIVLIAQVLFGAPMGYERWAGIFSSQ
WMKVLTFVVIVSLAWHAWVGVRDIWMDYVKPVGVRLLLQVLTISWLVGCAGWAIQVLWRL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaactacggatccaagcgcatcgtcgtcggtgcgcactacggtctgcgcgac
tggctcagccagcgcgtcacggccgcgctgatggcgatcttcaccatcgtgctgatcgct
caggtgctgttcggcgcgccgatgggctacgaacgctgggccggcatcttctcgtcgcag
tggatgaaggtgctgaccttcgtcgtcatcgtgtcgctggcctggcacgcctgggtcggc
gtgcgcgacatctggatggactacgtcaagccggtcggggtgcgcctgctgctgcaggtg
ttgacgatctcgtggctggtcggttgtgccggctgggcgatccaagtgctgtggaggctg
tga

DBGET integrated database retrieval system