KEGG   Methylibium petroleiphilum: Mpe_A2169Help
Entry
Mpe_A2169         CDS       T00470                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00020  Citrate cycle (TCA cycle)
mpt00190  Oxidative phosphorylation
mpt00650  Butanoate metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01130  Biosynthesis of antibiotics
mpt01200  Carbon metabolism
Module
mpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mpt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpe_A2169
   00650 Butanoate metabolism
    Mpe_A2169
  Energy metabolism
   00190 Oxidative phosphorylation
    Mpe_A2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt TcpE
Motif
Other DBs
NCBI-ProteinID: ABM95125
UniProt: A2SHT6
Position
complement(2327261..2327623)
Genome map
AA seq 120 aa AA seqDB search
MTQNYGSKRIVVGAHYGLRDWLSQRVTAALMAIFTIVLIAQVLFGAPMGYERWAGIFSSQ
WMKVLTFVVIVSLAWHAWVGVRDIWMDYVKPVGVRLLLQVLTISWLVGCAGWAIQVLWRL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaactacggatccaagcgcatcgtcgtcggtgcgcactacggtctgcgcgac
tggctcagccagcgcgtcacggccgcgctgatggcgatcttcaccatcgtgctgatcgct
caggtgctgttcggcgcgccgatgggctacgaacgctgggccggcatcttctcgtcgcag
tggatgaaggtgctgaccttcgtcgtcatcgtgtcgctggcctggcacgcctgggtcggc
gtgcgcgacatctggatggactacgtcaagccggtcggggtgcgcctgctgctgcaggtg
ttgacgatctcgtggctggtcggttgtgccggctgggcgatccaagtgctgtggaggctg
tga

DBGET integrated database retrieval system