KEGG   Methylibium petroleiphilum: Mpe_A2532Help
Entry
Mpe_A2532         CDS       T00470                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mpt  Methylibium petroleiphilum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2701057..2701647)
Genome map
AA seq 196 aa AA seqDB search
MAASSTLESLTEALRRLPGVGVKSAQRMAYHLLQHDREGALRLARALEQAVATVRHCERC
NTFTEAPVCSTCLDPARERRQLCVVETPADQAAVERSGSYHGLYFVLMGRLSPLDGIGVH
DIGLEKLLARATDGEVQELIVATNFTAEGEATAHVIAQALKGRGPSVTRLARGVPVGSEL
EYVDLGTIAHALSDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtcgtccacgcttgagtcgctgaccgaggccttgcgccgcttgccgggtgtg
ggcgtgaagtcggcgcagcgcatggcctaccacctgctgcagcacgatcgcgagggcgcg
ctgcggctcgcgcgtgcgctggagcaggccgtggcgacggtgaggcactgcgagcgctgc
aacaccttcaccgaggccccggtgtgcagcacctgcctcgatccggcgcgtgaacgccgg
cagttgtgcgtggtcgagacgccggccgatcaggcagcggtcgagcgcagcggcagctac
cacgggctgtacttcgtgttgatggggcggctgagcccgctcgatggcatcggggtgcac
gacatcgggctggagaaactgctggcgcgtgccaccgatggcgaggtgcaggaactgatc
gtcgccaccaacttcaccgccgaaggcgaggccaccgcgcacgtgatcgcccaggccctg
aagggccgaggcccgagcgtcacgcggctggcgcgcggcgtgccggtcggcagcgaactc
gagtacgtggacctgggcaccatcgcccatgcattgagcgatcgacgctag

DBGET integrated database retrieval system