KEGG   Methylibium petroleiphilum: Mpe_A2702Help
Entry
Mpe_A2702         CDS       T00470                                 

Gene name
cheB
Definition
chemotaxis response regulator (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mpt  Methylibium petroleiphilum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mpt02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mpt02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2874481..2875569
Genome map
AA seq 362 aa AA seqDB search
MAKIRVVVVDDSALVRSLLTEIINREPDMSCVGAASDPIVAREMIRNLDPDVITLDVEMP
RMDGIDFLSRLMRLRPTPVVMVSTLTERGAEVTLKALELGAVDFVAKPKIGVADGLRQLG
ADITEKIRTAAQARVRKLVTAPSPAPGASAPRAAAPAASLGRLSTEKIVFIGASTGGTEA
TKEVLMALPADAPAVVITQHMPPGFTTSYANRLDGLCRISVREARDGERVLPGHAYIAPG
GLHLSVERSGANYVARVQDGEPVNRHKPSVEVLFKSAARVVGPNAIGIMLTGMGADGAKA
MREMRDAGSYNLCQDEASCVVFGMPREAIAAGAAHEVLPLSQIAPHLLDRLRSTAGLSLN
RV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatccgtgtggtggtggtggacgattcggcgctggtgcgcagcctgctcacc
gagatcatcaaccgcgaaccggacatgagctgcgtcggcgcggccagcgacccgatcgtc
gcgcgcgagatgatccgcaacctcgatcccgacgtcatcacgctcgacgtcgagatgccg
cgcatggacggcatcgacttcctgtcgcgcctgatgcggctgcgtcccacaccggtggtg
atggtgtccacgctgaccgagcgcggtgccgaagtcacgctgaaggcgctggaactgggc
gccgtcgactttgtcgccaagccgaagatcggcgtcgccgatggcctgcgccagctcggc
gccgacatcaccgagaagatccgcaccgcggcccaggcccgcgtgcgcaagctggtcacg
gcgccgtcgccggcgcccggtgccagcgcaccgcgcgcggccgcgccggctgccagcctg
ggccgtctgtcgaccgagaagatcgtgttcatcggcgcttcgaccggcggcaccgaggcc
accaaggaggtgctgatggcgctgccggccgacgccccggccgtcgtgatcacccagcac
atgccacccggcttcacgaccagctacgcgaaccggctcgacggcctgtgccgcatcagc
gtgcgcgaggcacgcgacggcgagcgcgtgctgcccgggcacgcctacatcgcccccggc
ggcctgcacctgagcgtggagcgcagcggcgccaactacgtcgcccgcgtgcaggacggt
gagccggtcaaccgccacaagcccagcgtcgaggtgctgttcaagagcgcggcccgcgtg
gtgggcccgaacgcgatcggcatcatgctgaccggcatgggcgccgacggcgccaaggca
atgcgtgagatgcgcgacgccggcagctacaacctgtgccaggacgaggcgagctgcgtg
gtgttcggcatgccgcgcgaggccatcgcggccggcgcggcgcacgaggtgctgccgctg
tcgcagatcgcaccgcacctgctcgatcgcctgcgcagcaccgcgggcctctcgctcaac
cgggtctga

DBGET integrated database retrieval system