KEGG   Methylibium petroleiphilum: Mpe_A2776Help
Entry
Mpe_A2776         CDS       T00470                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpe_A2776
   01230 Biosynthesis of amino acids
    Mpe_A2776
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpe_A2776
   00030 Pentose phosphate pathway
    Mpe_A2776
   00051 Fructose and mannose metabolism
    Mpe_A2776
   00052 Galactose metabolism
    Mpe_A2776
  Energy metabolism
   00680 Methane metabolism
    Mpe_A2776
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mpe_A2776
Enzymes [BR:mpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mpe_A2776
Protein phosphatases and associated proteins [BR:mpt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mpe_A2776
Messenger RNA biogenesis [BR:mpt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mpe_A2776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2957363..2958625
Genome map
AA seq 420 aa AA seqDB search
MAKQKRNAFYAQSGGVTAVINASACGVIETARRHKDRIGKVYAGRDGIIGALTEDLIDTG
KESATAIAALRSTPSGAFGSCRYKLKSLEANRREYERLIEVFRAHDIGYFFYNGGGDSAD
TCFKVSQLSEAMGYPVQAIHVPKTIDNDLAFTDCCPGFGSVAKYVAVSTLEASFDVRSMA
KTSTKVFVVEVMGRHAGWIAAAAGLVEEQGIPVVILFPEIVFDEPEFLARVDQLVRQHGY
CTVVVSEGCHHADGSFLAEQGARDAFGHAQLGGAAPVVANLIKQALGHKFHWAVADYLQR
SARHIASKTDVTQAYALGRKAVELALQGHNAVMPTIERLSDAPYKYRIGMAPLAKVANVE
KFMPRDFISKDGFGITEKCRRYLRPLIQGEDYPRFTNGLPRYVSLKNVAVPKKLAAFDLK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagaagagaaacgcgttctatgcccagtcgggcggcgtgacggcggtcatc
aatgcctcggcctgcggcgtgatcgagacggcgcgccgccacaaggaccgcatcggcaag
gtctacgccggccgcgacggcatcatcggcgcgctgaccgaggacctgatcgacaccggc
aaggagtcggccacggcgatcgccgcgctgcgctccacgccgtcgggcgcgttcggctcc
tgccgctacaagctcaagtcgctcgaggcgaaccggcgcgagtacgaacgcctgatcgag
gtgttccgcgcgcacgacatcggctacttcttctacaacggtggcggcgactcggccgac
acctgcttcaaggtcagccagctgtcggaggccatgggctacccggtgcaggcgatccac
gtgcccaagaccatcgacaacgacctcgccttcaccgactgctgccccggcttcggctcg
gtggccaagtacgtcgcggtgtcgacgctcgaggcctcgttcgacgtgcgctcgatggcc
aagacctcgaccaaggtgttcgtcgtcgaggtcatgggccgccatgccggctggatcgcc
gcggccgccggcctggtcgaggagcagggcatcccggtggtgatcctttttcccgagatc
gtgttcgacgagccggaattccttgcccgcgtcgaccagctcgtccggcagcacggctac
tgcaccgtggtggtgtccgaagggtgccaccacgcggacggcagcttcctcgccgagcag
ggcgcgcgcgacgccttcggccacgcgcagctcggcggcgcagcgccggtggtggccaac
ctcatcaagcaggcactcggccacaagttccactgggccgtggccgactacctgcagcgc
tcggcgcgccacatcgcgtcgaagaccgacgtgacccaggcctacgcgctggggcgaaag
gcggtcgagctcgcgctgcagggccacaacgcggtgatgccgacgatcgagcgcctgtcc
gatgcgccgtacaagtaccgcatcggcatggcgccactggcaaaggtggccaacgtcgag
aagttcatgccgcgcgacttcatctccaaggacggcttcggtatcaccgagaagtgccgc
cgctacctgcgaccgctgatccagggcgaggactatccgcgtttcaccaacggcctgccg
cgctacgtgagcctgaagaacgtggcagtgccgaagaagctggctgccttcgacctgaag
tag

DBGET integrated database retrieval system