KEGG   Methylibium petroleiphilum: Mpe_A3001Help
Entry
Mpe_A3001         CDS       T00470                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpt  Methylibium petroleiphilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpe_A3001
Enzymes [BR:mpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mpe_A3001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3190949..3191776)
Genome map
AA seq 275 aa AA seqDB search
MRVLVTRPEEQAREWVARLTERGVAAAALPLIAIEAPADPAPVRLAWQTLPQRSLLVFVS
PNAVTQFFSQRPAGCEWQATLRFGSPGPGTSAALRAAGVAPGAIVEPPPDAGRFDSEALW
AVLGPQGPWQGRSVLIVRGSVDGEAQGQGREWLSQVLRDAGASIDLVAAYRRAPPRLDAA
GQALWAAALAAPVEHVWLFSSSEAIDQLDALAAAAGTAPDWRTAQALATHPRIAQRARRA
GFGRVIEAPPTLEAVVAAIGVSRSDGERPIESLAP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtcacccgtcccgaggagcaggcacgcgagtgggtggcgcggctgacc
gagcgcggggtcgcggcggcggccttgccgctgatcgcgatcgaggcgccggccgacccg
gcgccggtgcggctggcatggcagacgctgccgcagcgcagcctgctggtgttcgtgagc
ccgaatgcagtgacgcagttcttttcgcagcggccggccggctgtgagtggcaggccacg
ctgcgcttcggctcgccggggccgggcaccagcgcggccttgcgtgcggccggcgtggcg
ccgggcgcgatcgtcgagccgccgcccgacgcggggcgcttcgattcggaggccctgtgg
gccgtgctcggcccgcagggcccgtggcagggccgctcggtgctgatcgtgcgcggcagc
gtcgacggggaggcgcagggccagggccgcgagtggctgtcgcaggtgctgcgcgacgcc
ggggccagcatcgacctcgtggccgcctaccgtcgcgcgccaccgcggctggatgcagcg
gggcaggcgctgtgggccgctgcactggcggcaccggtcgagcacgtgtggctgttcagc
agttcggaggccatcgatcagctcgacgcgctggccgcggccgccggcaccgcacccgac
tggcggaccgcgcaggcgttggcgacgcatccgcgcatcgcccagcgcgcgcgcagggct
ggcttcggccgggtgatcgaggcgcccccgacgctggaggcggtggtcgccgcgatcggt
gtgtcacggtccgatggagagcggccgatagaatcgttagcaccgtga

DBGET integrated database retrieval system