KEGG   Methylibium petroleiphilum: Mpe_A3022Help
Entry
Mpe_A3022         CDS       T00470                                 

Definition
(GenBank) regulatory inactivation of DnaA Hda protein
  KO
K10763  
DnaA-homolog protein
Organism
mpt  Methylibium petroleiphilum
Brite
DNA replication proteins [BR:mpt03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    Mpe_A3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3213781..3214461)
Genome map
AA seq 226 aa AA seqDB search
MKQLPLQLGPGPAQSFENFAVGANAAAVGAVRAASASPTPLYLWGPAGAGKSHLLRALAR
EAAVQGRRVGAFGPSLETPWTWGEGVDLVLLDGCDDFDAARQHAAFALFVEAATHRVPVV
AAGRLPPVDLPVREDLRTRLGWGPVFQLLPLAEAEMRVTLQREAGRRGIALSDDVTGYLL
TRFARDLGSLMALLDALDEFALSEQRAVTVPLLKRMLAEQTTKEGA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgcccttgcagctcgggcccggcccggcgcagagcttcgagaacttcgcg
gtgggcgccaatgcggcggccgtcggcgccgtgcgcgcggcatcggcctcgccgaccccg
ctctacctgtgggggccggccggtgccggcaagtcccacctgctgcgtgcgctggcccgc
gaggcggcggtgcagggccggcgcgtcggtgccttcggtccgtcgctcgagacgccctgg
acctggggcgaaggcgtcgacctggtgctgctcgacggctgcgacgacttcgacgctgcc
cggcagcacgccgccttcgcgctgttcgtcgaggccgcgacgcaccgtgtgccggtggtc
gcggccgggcgcctgccgccggtcgacctgccggtgcgcgaggacctgcgcacgcgcctg
ggctgggggccggtgttccagctgctgccgctcgccgaggcggagatgcgcgtcacgctg
cagcgcgaggcaggccgccgcggcatcgcgctgtcggacgacgtgacgggctatctactg
acccgtttcgcgcgtgatctcggctcgctgatggcgctgctggacgcgctggacgaattt
gcgctcagcgagcagcgcgcggtcaccgtgcccctgctcaagcgcatgctggccgagcag
accacgaaggaaggtgcatga

DBGET integrated database retrieval system