KEGG   Methylibium petroleiphilum: Mpe_A3322Help
Entry
Mpe_A3322         CDS       T00470                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
mpt  Methylibium petroleiphilum
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mpe_A3322
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpe_A3322
   00650 Butanoate metabolism
    Mpe_A3322
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mpe_A3322
   00622 Xylene degradation
    Mpe_A3322
   00621 Dioxin degradation
    Mpe_A3322
Enzymes [BR:mpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mpe_A3322
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Mpe_A3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3528249..3529172)
Genome map
AA seq 307 aa AA seqDB search
MATKKIRCALIGSGNIGTDLIYKLKRSAVLEPVWMVGIDAASEGLQRARDLGLKTTAEGV
DGLLPHVKADGIQIAFDATSAYVHPENSRKLNALGVLMVDLTPAAVGPLCVPPVNLREHA
AKLEMNVNMISCAGQATIPIVYAVSRVQPVDYAEIVASLASKSIGPGTRANLDEFTYTTS
DALVRVGGARRGKALAVINPAEPPMIMRNTINCLTDDEPQQARIIDSVLSMIEEVQQYVP
GYKLVNGPVFDGRRVSVFMQVAGLGDYLPTYAGNLDIMTAAACRTAEMFAEEILAGTLQL
TPVKEAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagaagatccgctgtgccctgatcggctccggcaacatcggcaccgacctg
atctacaagttgaagcgcagcgcggtgctggagccggtgtggatggtcggcatcgacgcc
gcctccgaaggcctgcagcgcgcccgcgacctgggcctgaagaccaccgccgagggcgtg
gacggcctgctgccgcatgtgaaggccgacggcatccagatcgccttcgacgccaccagc
gcctacgtgcaccccgagaactcgcgcaagctcaatgcgctgggcgtgctgatggtcgac
ctcacgcccgcggcggtgggcccgctgtgcgtgccgccggtcaacctgcgcgagcatgcc
gccaagctggagatgaacgtcaacatgatctcctgcgccggccaggccaccatccccatc
gtgtatgccgtttcgcgcgtgcagccggtcgactacgccgagatcgtggccagcctcgcc
tccaagtccatcggcccgggcacccgcgccaacctcgacgagttcacctacaccacctcc
gacgcgctggtgcgcgtgggcggcgcgcggcgcggcaaggcgctggcggtcatcaacccg
gccgagccgccgatgatcatgcgcaacaccatcaactgcctgaccgacgacgagccgcag
caggcccgcatcatcgactcggtgctgtcgatgatcgaggaggtgcagcagtacgtgccc
ggctacaagctggtcaacggcccggtgttcgacggcaggcgcgtcagcgtcttcatgcag
gtggccggcctcggtgactacctgcccacctatgccggcaacctggacatcatgaccgct
gcggcctgccgcaccgcggagatgttcgccgaggagatcctcgccggcacgctgcaactc
acccccgtgaaggaggctgcctga

DBGET integrated database retrieval system