KEGG   Methylibium petroleiphilum: Mpe_A3322Help
Entry
Mpe_A3322         CDS       T00470                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00362  Benzoate degradation
mpt00620  Pyruvate metabolism
mpt00621  Dioxin degradation
mpt00622  Xylene degradation
mpt00650  Butanoate metabolism
mpt01100  Metabolic pathways
mpt01120  Microbial metabolism in diverse environments
mpt01220  Degradation of aromatic compounds
Module
mpt_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpe_A3322
   00650 Butanoate metabolism
    Mpe_A3322
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mpe_A3322
   00622 Xylene degradation
    Mpe_A3322
   00621 Dioxin degradation
    Mpe_A3322
Enzymes [BR:mpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mpe_A3322
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Mpe_A3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABM96275
UniProt: A2SL36
Position
complement(3528249..3529172)
Genome map
AA seq 307 aa AA seqDB search
MATKKIRCALIGSGNIGTDLIYKLKRSAVLEPVWMVGIDAASEGLQRARDLGLKTTAEGV
DGLLPHVKADGIQIAFDATSAYVHPENSRKLNALGVLMVDLTPAAVGPLCVPPVNLREHA
AKLEMNVNMISCAGQATIPIVYAVSRVQPVDYAEIVASLASKSIGPGTRANLDEFTYTTS
DALVRVGGARRGKALAVINPAEPPMIMRNTINCLTDDEPQQARIIDSVLSMIEEVQQYVP
GYKLVNGPVFDGRRVSVFMQVAGLGDYLPTYAGNLDIMTAAACRTAEMFAEEILAGTLQL
TPVKEAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagaagatccgctgtgccctgatcggctccggcaacatcggcaccgacctg
atctacaagttgaagcgcagcgcggtgctggagccggtgtggatggtcggcatcgacgcc
gcctccgaaggcctgcagcgcgcccgcgacctgggcctgaagaccaccgccgagggcgtg
gacggcctgctgccgcatgtgaaggccgacggcatccagatcgccttcgacgccaccagc
gcctacgtgcaccccgagaactcgcgcaagctcaatgcgctgggcgtgctgatggtcgac
ctcacgcccgcggcggtgggcccgctgtgcgtgccgccggtcaacctgcgcgagcatgcc
gccaagctggagatgaacgtcaacatgatctcctgcgccggccaggccaccatccccatc
gtgtatgccgtttcgcgcgtgcagccggtcgactacgccgagatcgtggccagcctcgcc
tccaagtccatcggcccgggcacccgcgccaacctcgacgagttcacctacaccacctcc
gacgcgctggtgcgcgtgggcggcgcgcggcgcggcaaggcgctggcggtcatcaacccg
gccgagccgccgatgatcatgcgcaacaccatcaactgcctgaccgacgacgagccgcag
caggcccgcatcatcgactcggtgctgtcgatgatcgaggaggtgcagcagtacgtgccc
ggctacaagctggtcaacggcccggtgttcgacggcaggcgcgtcagcgtcttcatgcag
gtggccggcctcggtgactacctgcccacctatgccggcaacctggacatcatgaccgct
gcggcctgccgcaccgcggagatgttcgccgaggagatcctcgccggcacgctgcaactc
acccccgtgaaggaggctgcctga

DBGET integrated database retrieval system