KEGG   Methylibium petroleiphilum: Mpe_A3460Help
Entry
Mpe_A3460         CDS       T00470                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01130  Biosynthesis of antibiotics
mpt01230  Biosynthesis of amino acids
Module
mpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpe_A3460
Enzymes [BR:mpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mpe_A3460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C DUF3730 G6PD_bact
Motif
Other DBs
NCBI-ProteinID: ABM96413
UniProt: A2SLH4
Position
complement(3669829..3670632)
Genome map
AA seq 267 aa AA seqDB search
MSGEDILQKIVAVKRDEIVAARKRRSLASLRADAESAERRADLRDFTGALRGCVAAGRPA
VIAEVKKASPSKGVLREHFVPAAIAESYARHGAACLSVLTDERFFQGSVDYLLAARAACP
LPVLRKDFMVDDYQVFEAREMGADCILLIAACLADAQMADLEAVAQAIGLAVLVEVHDGA
ELDRALRLKTPLVGINNRNLRTFEVTLDTTLGLLPRVPPDRLLVTESGILAPADVRRMRE
AQVHAFLVGEAFMRAPDPGLALAALFG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgaagacatcctgcagaagatcgtcgcggtcaagcgggacgagatcgtggcc
gcgcgcaagcggcgctcccttgcctcgctgcgcgccgacgcagagtcggccgaacggcgc
gccgacctgcgcgacttcaccggcgcgctgcgcgggtgcgtcgcggccggccggccggcg
gtgatcgccgaggtcaagaaggccagcccgagcaagggcgtgctgcgcgagcacttcgtg
ccggcggcgatcgccgagagctacgcccgccacggcgcggcctgcctgtcggtgctgacc
gacgagcgcttcttccagggctcggtcgactacctgttggccgcccgcgccgcctgcccg
ctgccggtgctgcgcaaggacttcatggtcgacgactaccaggtgttcgaggcgcgcgag
atgggtgccgactgcatcctgctgatcgccgcctgcctggccgacgcccagatggccgac
ctggaagcggtggcgcaggcgatcggcctggcggtgctggtcgaggtgcacgacggcgcc
gaactcgaccgcgcgctgcggctgaagactccgctggtcggcatcaacaaccgcaacctg
cggaccttcgaggtcacgctcgacaccacgctgggcctgttgccgcgcgtgccgccggac
cgcctgctggtgaccgagagcggcatcctcgctccggccgacgtgcggcgcatgcgcgag
gcccaggtgcacgccttcctggtcggcgaagccttcatgcgcgcgcccgatcccggcttg
gcgctggccgcgctgttcggctga

DBGET integrated database retrieval system