KEGG   Methylibium petroleiphilum: Mpe_A3505Help
Entry
Mpe_A3505         CDS       T00470                                 

Definition
phospholipase A1 (PldA) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mpe_A3505
   00565 Ether lipid metabolism
    Mpe_A3505
   00590 Arachidonic acid metabolism
    Mpe_A3505
   00591 Linoleic acid metabolism
    Mpe_A3505
   00592 alpha-Linolenic acid metabolism
    Mpe_A3505
Enzymes [BR:mpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Mpe_A3505
    3.1.1.32  phospholipase A1
     Mpe_A3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3714966..3716048)
Genome map
AA seq 360 aa AA seqDB search
MKSTALSVLLLAWPWAVVSAQEAAAPALADCAALTDDGLRLACYDRLAGREAPPVPVVPA
GRTPDVVARPAPEVGGNGLQGPPTPAPSFLSKYWELDRADKRGTFNFTGYRPNFLLPVHV
TTRLNTRPSSPSPDRTAELGDYKRVEAKFQLSLRTKIAQSVLLPDADLWVGYTQQSLWQL
YNKGDSAPFRSSDYEPEVMYVVPVPEGLRALPWGWQWRYGMLAFAHQSNGQTKPLSRSWN
RVYAGAGFEREDVSIALRLNRRVRENADDDDNPDLTSYRGRGDVTLNWTPGRATAALLWR
TNFRDLRRGAVQFDWTFPVEPGSPRALRWYVQLFSGYGETLLDYNFRQTSLGLGLTLFEF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgaccgccctctccgtcctgctgctggcctggccctgggctgtcgtgtcggcg
caggaggcagcggcgcccgcgctggccgattgcgcggcgctcaccgacgacggcctgcgg
ctggcctgctacgaccggctggccggccgcgaggcgccgccggtgccggtggtgccggcc
ggccgcacgcccgacgtggtcgcccggccggcaccggaagtgggcggcaacggcctgcag
ggtccgccgactccggcaccgagcttcctgtccaagtactgggaactcgaccgcgccgac
aagcgcggcaccttcaacttcaccggctaccgacccaacttcctgctgccggtgcacgtg
accacgcgcctgaacacccgtccgtccagccccagcccggaccgcacggccgaactcggc
gactacaagcgcgtggaggccaagttccagctctcgctgcggaccaagatcgcgcagagc
gtgctgctgcccgacgccgacctctgggtcggctacacgcagcagtcgctctggcagctc
tacaacaagggcgattccgcccccttccgcagcagcgactacgaacccgaggtgatgtac
gtggtgccggtgcccgagggtctgcgggcgctgccgtggggctggcagtggcgctacggc
atgctggccttcgcccaccagtccaacggccagaccaagccgctgtcgcgcagctggaac
cgcgtctacgcgggcgccggcttcgagcgcgaggacgtctcgatcgcgctgcgcctgaac
cggcgcgtgcgcgagaacgccgatgacgacgacaaccccgatctcaccagctaccgcggt
cgcggcgacgtgacgctgaactggacccccggccgcgcgaccgccgcgctgctgtggcgt
accaacttccgcgacctgcggcgcggcgccgtgcagttcgactggaccttcccggtcgag
cccggcagcccgcgcgcgttgcgctggtacgtgcagctgttcagcggctacggcgagacc
ctgctcgactacaacttccgccagaccagcctggggctggggctcacgctgttcgagttc
tga

DBGET integrated database retrieval system